KEGG   Homo sapiens (human): 9368Help
Entry
9368              CDS       T01001                                 

Gene name
SLC9A3R1, EBP50, NHERF, NHERF-1, NHERF1, NPHLOP2
Definition
(RefSeq) SLC9A3 regulator 1
  KO
K13365  Na(+)/H(+) exchange regulatory cofactor NHE-RF1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05165  Human papillomavirus infection
Network
N00193  HPV E6 to host-cell-protein inhibition
Disease
H00888  Nephrolithiasis/osteoporosis, hypophosphatemic
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    9368 (SLC9A3R1)
 Organismal Systems
  Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    9368 (SLC9A3R1)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    9368 (SLC9A3R1)
Transporters [BR:hsa02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   9368 (SLC9A3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EBP50_C PDZ PDZ_2 GRASP55_65 HoxA13_N
Motif
Other DBs
NCBI-GeneID: 9368
NCBI-ProteinID: NP_004243
OMIM: 604990
HGNC: 11075
Ensembl: ENSG00000109062
Vega: OTTHUMG00000178863
Pharos: O14745(Tbio)
UniProt: O14745
Structure
PDB: 

Jmol
Position
17q25.1
AA seq 358 aa AA seqDB search
MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLV
EVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQA
EPPAAAEVQGAGNENEPREADKSHPEQRELRPRLCTMKKGPSGYGFNLHSDKSKPGQFIR
SVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFK
KCRVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQ
DSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQKRSSKRAPQMDWSKKNELFSNL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggacgcagcggccggggcgcccctgccccggctctgctgcctggagaagggt
ccgaacggctacggcttccacctgcacggggagaagggcaagttgggccagtacatccgg
ctggtggagcccggctcgccggccgagaaggcggggctgctggcgggggaccggctggtg
gaggtgaacggcgaaaacgtggagaaggagacccaccagcaggtggtgagccgcatccgc
gccgcactcaacgccgtgcgcctgctggtggtcgaccccgagacggacgagcagctgcag
aagctcggcgtccaggtccgagaggagctgctgcgcgcccaggaagcgccggggcaggcc
gagccgccggccgccgccgaggtgcagggggctggcaacgaaaatgagcctcgcgaggcc
gacaagagccacccggagcagcgcgagcttcggcctcggctctgtaccatgaagaagggc
cccagtggctatggcttcaacctgcacagcgacaagtccaagccaggccagttcatccgg
tcagtggacccagactccccggctgaggcttcagggctccgggcccaggatcgcattgtg
gaggtgaacggggtctgcatggaggggaagcagcatggggacgtggtgtccgccatcagg
gctggcggggacgagaccaagctgctggtggtggacagggaaactgacgagttcttcaag
aaatgcagagtgatcccatctcaggagcacctgaatggtcccctgcctgtgcccttcacc
aatggggagatacagaaggagaacagtcgtgaagccctggcagaggcagccttggagagc
cccaggccagccctggtgagatccgcctccagtgacaccagcgaggagctgaattcccaa
gacagccccccaaaacaggactccacagcgccctcgtctacctcctcctccgaccccatc
ctagacttcaacatctccctggccatggccaaagagagggcccaccagaaacgcagcagc
aaacgggccccgcagatggactggagcaagaaaaacgaactcttcagcaacctctga

DBGET integrated database retrieval system