KEGG   Homo sapiens (human): 9368Help
Entry
9368              CDS       T01001                                 

Gene name
SLC9A3R1, EBP50, NHERF, NHERF-1, NHERF1, NPHLOP2
Definition
(RefSeq) SLC9A3 regulator 1
  KO
K13365  
Na(+)/H(+) exchange regulatory cofactor NHE-RF1
Organism
hsa  Homo sapiens (human)
Disease
H00888  
Nephrolithiasis/osteoporosis, hypophosphatemic
Brite
Transporters [BR:hsa02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   9368 (SLC9A3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.1
AA seq 358 aa AA seqDB search
MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLV
EVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQA
EPPAAAEVQGAGNENEPREADKSHPEQRELRPRLCTMKKGPSGYGFNLHSDKSKPGQFIR
SVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFK
KCRVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQ
DSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQKRSSKRAPQMDWSKKNELFSNL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggacgcagcggccggggcgcccctgccccggctctgctgcctggagaagggt
ccgaacggctacggcttccacctgcacggggagaagggcaagttgggccagtacatccgg
ctggtggagcccggctcgccggccgagaaggcggggctgctggcgggggaccggctggtg
gaggtgaacggcgaaaacgtggagaaggagacccaccagcaggtggtgagccgcatccgc
gccgcactcaacgccgtgcgcctgctggtggtcgaccccgagacggacgagcagctgcag
aagctcggcgtccaggtccgagaggagctgctgcgcgcccaggaagcgccggggcaggcc
gagccgccggccgccgccgaggtgcagggggctggcaacgaaaatgagcctcgcgaggcc
gacaagagccacccggagcagcgcgagcttcggcctcggctctgtaccatgaagaagggc
cccagtggctatggcttcaacctgcacagcgacaagtccaagccaggccagttcatccgg
tcagtggacccagactccccggctgaggcttcagggctccgggcccaggatcgcattgtg
gaggtgaacggggtctgcatggaggggaagcagcatggggacgtggtgtccgccatcagg
gctggcggggacgagaccaagctgctggtggtggacagggaaactgacgagttcttcaag
aaatgcagagtgatcccatctcaggagcacctgaatggtcccctgcctgtgcccttcacc
aatggggagatacagaaggagaacagtcgtgaagccctggcagaggcagccttggagagc
cccaggccagccctggtgagatccgcctccagtgacaccagcgaggagctgaattcccaa
gacagccccccaaaacaggactccacagcgccctcgtctacctcctcctccgaccccatc
ctagacttcaacatctccctggccatggccaaagagagggcccaccagaaacgcagcagc
aaacgggccccgcagatggactggagcaagaaaaacgaactcttcagcaacctctga

DBGET integrated database retrieval system