KEGG   Homo sapiens (human): 9370Help
Entry
9370              CDS       T01001                                 

Gene name
ADIPOQ, ACDC, ACRP30, ADIPQTL1, ADPN, APM-1, APM1, GBP28
Definition
adiponectin, C1Q and collagen domain containing
Orthology
K07296  
adiponectin
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Disease
H00967  
Adiponectin deficiency
Class
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:hsa04930]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q27
AA seq 244 aa AA seqDB search
MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDG
TPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLE
TYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK
AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLY
HDTN
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgctgggagctgttctactgctattagctctgcccggtcatgaccaggaaacc
acgactcaagggcccggagtcctgcttcccctgcccaagggggcctgcacaggttggatg
gcgggcatcccagggcatccgggccataatggggccccaggccgtgatggcagagatggc
acccctggtgagaagggtgagaaaggagatccaggtcttattggtcctaagggagacatc
ggtgaaaccggagtacccggggctgaaggtccccgaggctttccgggaatccaaggcagg
aaaggagaacctggagaaggtgcctatgtataccgctcagcattcagtgtgggattggag
acttacgttactatccccaacatgcccattcgctttaccaagatcttctacaatcagcaa
aaccactatgatggctccactggtaaattccactgcaacattcctgggctgtactacttt
gcctaccacatcacagtctatatgaaggatgtgaaggtcagcctcttcaagaaggacaag
gctatgctcttcacctatgatcagtaccaggaaaataatgtggaccaggcctccggctct
gtgctcctgcatctggaggtgggcgaccaagtctggctccaggtgtatggggaaggagag
cgtaatggactctatgctgataatgacaatgactccaccttcacaggctttcttctctac
catgacaccaactga

DBGET integrated database retrieval system