KEGG   Homo sapiens (human): 9370Help
Entry
9370              CDS       T01001                                 

Gene name
ADIPOQ, ACDC, ACRP30, ADIPQTL1, ADPN, APM-1, APM1, GBP28
Definition
adiponectin, C1Q and collagen domain containing
Orthology
K07296  
adiponectin
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
AMPK signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Disease
H00967  
Adiponectin deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    9370 (ADIPOQ)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    9370 (ADIPOQ)
   03320 PPAR signaling pathway
    9370 (ADIPOQ)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    9370 (ADIPOQ)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    9370 (ADIPOQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q27
AA seq 244 aa AA seqDB search
MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDG
TPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLE
TYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK
AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLY
HDTN
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgctgggagctgttctactgctattagctctgcccggtcatgaccaggaaacc
acgactcaagggcccggagtcctgcttcccctgcccaagggggcctgcacaggttggatg
gcgggcatcccagggcatccgggccataatggggccccaggccgtgatggcagagatggc
acccctggtgagaagggtgagaaaggagatccaggtcttattggtcctaagggagacatc
ggtgaaaccggagtacccggggctgaaggtccccgaggctttccgggaatccaaggcagg
aaaggagaacctggagaaggtgcctatgtataccgctcagcattcagtgtgggattggag
acttacgttactatccccaacatgcccattcgctttaccaagatcttctacaatcagcaa
aaccactatgatggctccactggtaaattccactgcaacattcctgggctgtactacttt
gcctaccacatcacagtctatatgaaggatgtgaaggtcagcctcttcaagaaggacaag
gctatgctcttcacctatgatcagtaccaggaaaataatgtggaccaggcctccggctct
gtgctcctgcatctggaggtgggcgaccaagtctggctccaggtgtatggggaaggagag
cgtaatggactctatgctgataatgacaatgactccaccttcacaggctttcttctctac
catgacaccaactga

DBGET integrated database retrieval system