KEGG   Homo sapiens (human): 9372Help
Entry
9372              CDS       T01001                                 

Gene name
ZFYVE9, MADHIP, NSP, PPP1R173, SARA, SMADIP
Definition
zinc finger, FYVE domain containing 9
Orthology
K04679  
MAD, mothers against decapentaplegic interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    9372 (ZFYVE9)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    9372 (ZFYVE9)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     9372 (ZFYVE9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p32.3
AA seq 1425 aa AA seqDB search
MENYFQAEAYNLDKVLDEFEQNEDETVSSTLLDTKWNKILDPPSHRLSFNPTLASVNESA
VSNESQPQLKVFSLAHSAPLTTEEEDHCANGQDCNLNPEIATMWIDENAVAEDQLIKRNY
SWDDQCSAVEVGEKKCGNLACLPDEKNVLVVAVMHNCDKRTLQNDLQDCNNYNSQSLMDA
FSCSLDNENRQTDQFSFSINESTEKDMNSEKQMDPLNRPKTEGRSVNHLCPTSSDSLASV
CSPSQLKDDGSIGRDPSMSAITSLTVDSVISSQGTDGCPAVKKQENYIPDEDLTGKISSP
RTDLGSPNSFSHMSEGILMKKEPAEESTTEESLRSGLPLLLKPDMPNGSGRNNDCERCSD
CLVPNEVRADENEGYEHEETLGTTEFLNMTEHFSESQDMTNWKLTKLNEMNDSQVNEEKE
KFLQISQPEDTNGDSGGQCVGLADAGLDLKGTCISESEECDFSTVIDTPAANYLSNGCDS
YGMQDPGVSFVPKTLPSKEDSVTEEKEIEESKSECYSNIYEQRGNEATEGSGLLLNSTGD
LMKKNYLHNFCSQVPSVLGQSSPKVVASLPSISVPFGGARPKQPSNLKLQIPKPLSDHLQ
NDFPANSGNNTKNKNDILGKAKLGENSATNVCSPSLGNISNVDTNGEHLESYEAEISTRP
CLALAPDSPDNDLRAGQFGISARKPFTTLGEVAPVWVPDSQAPNCMKCEARFTFTKRRHH
CRACGKVFCASCCSLKCKLLYMDRKEARVCVICHSVLMNAQAWENMMSASSQSPNPNNPA
EYCSTIPPLQQAQASGALSSPPPTVMVPVGVLKHPGAEVAQPREQRRVWFADGILPNGEV
ADAAKLTMNGTSSAGTLAVSHDPVKPVTTSPLPAETDICLFSGSITQVGSPVGSAMNLIP
EDGLPPILISTGVKGDYAVEEKPSQISVMQQLEDGGPDPLVFVLNANLLSMVKIVNYVNR
KCWCFTTKGMHAVGQSEIVILLQCLPDEKCLPKDIFNHFVQLYRDALAGNVVSNLGHSFF
SQSFLGSKEHGGFLYVTSTYQSLQDLVLPTPPYLFGILIQKWETPWAKVFPIRLMLRLGA
EYRLYPCPLFSVRFRKPLFGETGHTIMNLLADFRNYQYTLPVVQGLVVDMEVRKTSIKIP
SNRYNEMMKAMNKSNEHVLAGGACFNEKADSHLVCVQNDDGNYQTQAISIHNQPRKVTGA
SFFVFSGALKSSSGYLAKSSIVEDGVMVQITAENMDSLRQALREMKDFTITCGKADAEEP
QEHIHIQWVDDDKNVSKGVVSPIDGKSMETITNVKIFHGSEYKANGKVIRWTEVFFLEND
DQHNCLSDPADHSRLTEHVAKAFCLALCPHLKLLKEDGMTKLGLRVTLDSDQVGYQAGSN
GQPLPSQYMNDLDSALVPVIHGGACQLSEGPVVMELIFYILENIV
NT seq 4278 nt NT seq  +upstreamnt  +downstreamnt
atggagaattacttccaagcagaagcttacaacctggacaaggtgttagatgaatttgaa
caaaacgaagatgaaacagtttcttctactttattggatacaaagtggaataagattcta
gatcccccttctcaccggctgtcatttaaccctactttggccagtgtgaatgaatctgca
gtttctaatgagtcacaaccacaactgaaagtcttctccctggctcattcagctcccctg
accacagaggaagaggatcactgtgctaatggacaggactgtaatctaaatccagagatt
gccacaatgtggattgatgaaaatgctgttgcagaagaccagttaattaagagaaactat
agttgggatgatcaatgcagtgctgttgaagtgggagagaagaaatgtggaaacctggct
tgtctgccagatgagaagaatgttcttgttgtagccgtcatgcataactgtgataaaagg
acattacaaaacgatttacaggattgtaataattataatagtcaatcccttatggatgct
tttagctgttcactggataatgaaaacagacaaactgatcaatttagttttagtataaat
gagtccactgaaaaagatatgaattcagagaaacaaatggatccattgaatagaccgaaa
acagaggggagatctgttaaccatctgtgtcctacttcatctgatagtctagccagtgtc
tgttccccttcacaattaaaggatgacggaagtataggtagagacccctccatgtctgcg
attacaagtttaacggttgattcagtaatctcatcccagggaacagatggatgtcctgct
gttaaaaagcaagagaactatataccagatgaggacctcactggcaaaatcagctctcct
aggacagatctagggagtccaaattccttttcccacatgagtgaggggattttgatgaaa
aaagagccagcagaggagagcaccactgaagaatccctccggtctggtttacctttgctt
ctcaaaccagacatgcctaatgggtctggaaggaataatgactgtgaacggtgttcagat
tgccttgtgcctaatgaagttagggctgatgaaaatgaaggttatgaacatgaagaaact
cttggcactacagaattccttaatatgacagagcatttctctgaatctcaggacatgact
aattggaagttgactaaactaaatgagatgaatgatagccaagtaaacgaagaaaaggaa
aagtttctacagattagtcagcctgaggacactaatggtgatagtggaggacagtgtgtt
ggattggcagatgcaggtctagatttaaaaggaacttgcattagtgaaagtgaagaatgt
gatttctccactgttatagacacaccagcagcaaattatctatctaatggttgtgattcc
tatggaatgcaagacccaggtgtttcttttgttccaaagactttaccctccaaagaagat
tcagtaacagaagaaaaagaaatagaggaaagcaagtcagaatgctactcaaatatttat
gaacagagaggaaatgaggccacagaagggagtggactacttttaaacagcactggtgac
ctaatgaagaaaaattatttacataatttctgtagtcaagttccatcagtgcttgggcaa
tcttcccccaaggtagtagcaagcctgccatctatcagtgttccttttggtggtgcaaga
cccaagcaaccttctaatcttaaacttcaaattccaaagccattatcagaccatttacaa
aatgactttcctgcaaacagtggaaataatactaaaaataaaaatgatattcttgggaaa
gcaaaattaggggaaaactcagcaaccaatgtatgcagtccatctttgggaaacatctct
aatgtcgatacaaatggggaacatttagaaagttatgaggctgagatctccactagacca
tgccttgcattagctccagatagcccagataatgatctcagagctggtcagtttggaatt
tctgccagaaagccattcaccactctgggtgaggtggctccagtatgggtaccggattct
caggctccaaattgcatgaaatgtgaagccaggtttacattcaccaaaaggaggcatcac
tgcagagcatgtgggaaggttttctgtgcttcctgctgtagcctgaaatgtaaactgtta
tacatggacagaaaggaagctagagtgtgtgtaatctgccattcagtgctaatgaatgct
caagcctgggagaacatgatgagtgcctcaagccagagccctaaccctaacaatcctgct
gaatactgttctactatccctcccttgcagcaagctcaggcctcaggagctctgagctct
ccacctcccactgtgatggtacctgtgggagttttaaagcaccctggagcagaagtggct
cagcccagagagcagaggcgagtttggtttgctgatgggatcttgcccaatggagaagtt
gctgatgcagccaaattaacaatgaatggaacttcctctgcaggaaccctggctgtgtca
cacgacccagtcaagccagtaactaccagtcctctaccagcagagacggatatttgtcta
ttctctgggagtataactcaggttggaagtcctgttggaagtgcaatgaatcttattcct
gaagatggccttcctcccattctcatctccactggtgtaaaaggagactatgctgtggaa
gagaaaccatcacagatttcagtaatgcagcagttggaggatggtggccctgacccactt
gtatttgttttaaatgcaaatttgttgtcaatggttaaaattgtaaattatgtgaacagg
aagtgctggtgtttcacaaccaagggaatgcatgcagtgggtcagtctgagatagtcatt
cttctacagtgtttaccggatgaaaagtgtttgccaaaggatatctttaatcactttgtg
cagctttatcgggatgctctggcagggaatgtggtgagcaacttgggacattccttcttc
agtcaaagtttccttggcagtaaagaacatggtggattcttatatgtgacatctacctac
cagtcactgcaagacctagtactcccaaccccaccttacttgtttgggattcttatccag
aaatgggaaactccttgggctaaagtatttcctatccgtctgatgttgagacttggagct
gaatatcgactttatccatgcccactattcagtgtcagatttcggaagccattgtttgga
gagacggggcataccatcatgaatcttcttgcagacttcagaaattaccagtataccttg
ccagtagttcaaggtttggtggttgatatggaagttcggaaaactagcatcaaaattccc
agcaacagatacaatgagatgatgaaagccatgaacaagtccaatgagcatgtcctggca
ggaggtgcctgcttcaatgaaaaggcagactctcatcttgtgtgtgtacagaatgatgat
ggaaactatcagacccaggctatcagtattcacaatcagcccagaaaagtgactggtgcc
agtttctttgtgttcagtggcgctctgaaatcctcttctggataccttgccaagtccagt
attgtggaagatggtgttatggtccagattactgcagagaacatggattccttgaggcag
gcactgcgagagatgaaggacttcaccatcacctgtgggaaggcggacgcggaggaaccc
caggagcacatccacatccagtgggtggatgatgacaagaacgttagcaagggtgtcgta
agtcctatagatgggaagtccatggagactataacaaatgtgaagatattccatggatca
gaatataaagcaaatggaaaagtaatcagatggacagaggtgtttttcctagaaaacgat
gaccagcacaattgcctcagtgatcctgcagatcacagtagattgactgagcatgttgcc
aaagctttttgccttgctctctgtcctcacctgaaacttctgaaggaagatggaatgacc
aaactgggactacgtgtgacacttgactcagatcaggttggctatcaagcagggagcaat
ggccagccccttccctcgcagtacatgaatgatctggacagcgccttggtgccggtgatc
catggaggggcctgccagcttagtgagggccccgttgtcatggaactcatcttttatatt
ctggaaaacatcgtataa

DBGET integrated database retrieval system