KEGG   Homo sapiens (human): 9374Help
Entry
9374              CDS       T01001                                 

Gene name
PPT2, C6orf8, G14, PPT-2
Definition
palmitoyl-protein thioesterase 2 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    9374 (PPT2)
  Lipid metabolism
   00062 Fatty acid elongation
    9374 (PPT2)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    9374 (PPT2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     9374 (PPT2)
Lipid biosynthesis proteins [BR:hsa01004]
 Fatty acid synthase
  Component type
   9374 (PPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 302 aa AA seqDB search
MLGLCGQRLPAAWVLLLLPFLPLLLLAAPAPHRASYKPVIVVHGLFDSSYSFRHLLEYIN
ETHPGTVVTVLDLFDGRESLRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGGLVCRAL
LSVMDDHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEFSICNYWH
DPHHDDLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQSSFFG
FYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCIEPW
LS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctggggctctgcgggcagcggctccccgcggcgtgggtcctgcttctgttgcctttc
ctgccgctgctgctgcttgcagcccccgcgccccaccgcgcgtcctacaagccggtcatc
gtggtgcatgggctcttcgacagctcgtacagcttccgccacctgctggaatacatcaat
gagacacaccccgggactgtggtgacagtgctcgatctcttcgatgggagagagagcttg
cgacccctgtgggaacaggtgcaagggttccgagaggctgtggtccccatcatggcaaag
gcccctcaaggggtgcatctcatctgctactcgcaggggggccttgtgtgccgggctctg
ctttctgtcatggatgatcacaacgtggattctttcatctccctctcctctccacagatg
ggacagtatggagacacggactacttgaagtggctgttccccacctccatgcggtctaac
ctctatcggatctgctatagcccctggggccaggaattctccatctgcaactactggcat
gatccccaccacgatgacttgtacctcaatgccagcagcttcctggccctgatcaatggg
gaaagagaccatcccaatgccacagtatggcggaagaactttctgcgtgtgggccacctg
gtgctgattgggggccctgatgatggtgttattactccctggcagtccagcttctttggt
ttctatgatgcaaatgagaccgtcctggagatggaggagcaactggtttatctgcgggat
tcttttgggttgaagactctattggcccggggggccatagtgaggtgtccaatggccggt
atctcccacacagcctggcactccaaccgtaccctttatgagacctgcattgaaccttgg
ctctcctga

DBGET integrated database retrieval system