KEGG   Homo sapiens (human): 9376Help
Entry
9376              CDS       T01001                                 

Gene name
SLC22A8, OAT3
Definition
(RefSeq) solute carrier family 22 (organic anion transporter), member 8
  KO
K08205  
MFS transporter, OCT family, solute carrier family 22 (organic anion transporter), member 8
Organism
hsa  Homo sapiens (human)
Pathway
Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    9376 (SLC22A8)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   9376 (SLC22A8)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    9376 (SLC22A8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
11q11
AA seq 542 aa AA seqDB search
MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPW
VLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNK
LKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFR
FLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQL
TVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLN
LQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEEFGVNLYILQI
IFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKG
CLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGI
TALLGGSAALFLPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLG
SS
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaccttctcggagatcctggaccgtgtgggaagcatgggccatttccagttcctgcat
gtagccatactgggcctcccgatcctcaacatggccaaccacaacctgctgcagatcttc
acagccgccacccctgtccaccactgtcgcccgccccacaatgcctccacagggccttgg
gtgctccccatgggcccaaatgggaagcctgagaggtgcctccgttttgtacatccgccc
aatgccagcctgcccaatgacacccagagggccatggagccatgcctggatggctgggtc
tacaacagcaccaaggactccattgtgacagagtgggacttggtgtgcaactccaacaaa
ctgaaggagatggcccagtctatcttcatggcaggtatactgattggagggctcgtgctt
ggagacctgtctgacaggtttggccgcaggcccatcctgacctgcagctacctgctgctg
gcagccagcggctccggtgcagccttcagccccaccttccccatctacatggtcttccgc
ttcctgtgtggctttggcatctcaggcattaccctgagcaccgtcatcttgaatgtggaa
tgggtgcctacccggatgcgggccatcatgtcgacagcactcgggtactgctacaccttt
ggccagttcattctgcccggcctggcctacgccatcccccagtggcgttggctgcagtta
actgtgtccattcccttcttcgtcttcttcctatcatcctggtggacaccagagtccata
cgctggttggtcttgtctggaaagtcctcgaaggccctgaagatactccggcgggtggct
gtcttcaatggcaagaaggaagagggagaaaggctcagcttggaggagctcaaactcaac
ctgcagaaggagatctccttggccaaggccaagtacaccgcaagtgacctgttccggata
cccatgctgcgccgcatgaccttctgtctttccctggcctggtttgctaccggttttgcc
tactatagtttggctatgggtgtggaagaatttggagtcaacctctacatcctccagatc
atctttggtggggtcgatgtcccagccaagttcatcaccatcctctccttaagctacctg
ggccggcataccactcaggccgctgccctgctcctggcaggaggggccatcttggctctc
acctttgtgcccttggacttgcagaccgtgaggacagtattggctgtgtttgggaaggga
tgcctatccagctccttcagctgcctcttcctctacacaagtgaattataccccacagtc
atcaggcaaacaggtatgggcgtaagtaacctgtggacccgcgtgggaagcatggtgtcc
ccgctggtgaaaatcacgggtgaggtacagcccttcatccccaatatcatctacgggatc
accgccctcctcgggggcagtgctgccctcttcctgcctgagaccctgaatcagcccttg
ccagagactatcgaagacctggaaaactggtccctgcgggcaaagaagccaaagcaggag
ccagaggtggaaaaggcctcccagaggatccctctacagcctcacggaccaggcctgggc
tccagctga

DBGET integrated database retrieval system