KEGG   Homo sapiens (human): 9377Help
Entry
9377              CDS       T01001                                 

Gene name
COX5A, COX, COX-VA, VA
Definition
(RefSeq) cytochrome c oxidase subunit 5A (EC:1.9.3.1)
  KO
K02264  
cytochrome c oxidase subunit 5a
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    9377 (COX5A)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    9377 (COX5A)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    9377 (COX5A)
   05012 Parkinson's disease
    9377 (COX5A)
   05016 Huntington's disease
    9377 (COX5A)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    9377 (COX5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
15q24.1
AA seq 150 aa AA seqDB search
MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCYSHGSQETDEEFDARWVTYF
NKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHK
EIYPYVIQELRPTLNELGISTPEELGLDKV
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcgccgctctccgccgctgcgctgtggccgcaaccacccgggccgaccctcga
ggcctcctgcactccgcccggacccccggccccgccgtggctatccagtcagttcgctgc
tattcccatgggtcacaggagacagatgaggagtttgatgctcgctgggtaacatacttc
aacaagccagatatagatgcctgggaattgcgtaaagggataaacacacttgttacctat
gatatggttccagagcccaaaatcattgatgctgctttgcgggcatgcagacggttaaat
gattttgctagtacagttcgtatcctagaggttgttaaggacaaagcaggacctcataag
gaaatctacccctatgtcatccaggaacttagaccaactttaaatgaactgggaatctcc
actccggaggaactgggccttgacaaagtgtaa

DBGET integrated database retrieval system