KEGG   Homo sapiens (human): 9378Help
Entry
9378              CDS       T01001                                 

Gene name
NRXN1, Hs.22998, PTHSL2, SCZD17
Definition
(RefSeq) neurexin 1
  KO
K07377  
neurexin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Disease
H00756  
Pitt-Hopkins syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    9378 (NRXN1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    9378 (NRXN1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  NLGN; neuroligin [KO:K07378]
   9378 (NRXN1)
  DAG1; dystroglycan 1 [KO:K06265]
   9378 (NRXN1)
  LRRTM1_2; leucine-rich repeat transmembrane neuronal protein 1/2 [KO:K16665]
   9378 (NRXN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9ULB1(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2p16.3
AA seq 472 aa AA seqDB search
MYQRMLRCGAELGSPGGGGGGGGGGGAGGRLALLWIVPLTLSGLLGVAWGASSLGAHHIH
HFHGSSKHHSVPIAIYRSPASLRGGHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIG
FSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVV
RFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTI
FNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMT
TESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQTTDDILVASAECPSDDEDI
DPCEPSSGGLANPTRAGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKY
RNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSSNKNKKNKDKEYYV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagaggatgctccggtgcggcgccgagctgggctcgcccgggggcggcggcggc
ggcggcggcggcggcggcgcaggggggcgcctggccctgctttggatagtcccgctcacc
ctcagcggcctcctaggagtggcgtggggggcatccagtttgggagcgcaccacatccac
catttccatggcagcagcaagcatcattcagtgcctattgcaatctacaggtcaccggca
tccttgcgaggcggacacgctgggacgacatatatctttagcaaaggtggtggacaaatc
acgtataagtggcctcctaatgaccgacccagtacacgagcagacagactggccataggt
tttagcactgttcagaaagaagccgtattggtgcgagtggacagttcttcaggcttgggt
gactacctagaactgcatatacaccagggaaaaattggagttaagtttaatgttgggaca
gatgacatcgccattgaagaatccaatgcaatcattaatgatgggaaataccatgtagtt
cgtttcacgaggagtggtggcaatgccacgttgcaggtggacagctggccagtgatcgag
cgctaccctgcaggaaacaatgataacgagcgcctggcgattgctagacagcgaattcca
tatcgacttggtcgagtagttgatgaatggctactcgacaaagggcgtcagctcacaatc
ttcaatagccaagcaaccataataattggcgggaaagagcagggccagcccttccagggc
cagctctctgggctgtactacaatggcttgaaagttctgaatatggcagccgaaaacgat
gccaacatcgccatagtgggaaatgtgagactggttggtgaagtgccttcctctatgaca
actgagtcaacagccactgccatgcaatcagagatgtccacatcaattatggagactacc
acgaccctggctactagcacagccagaagaggaaagcccccgacaaaagaacccattagc
cagaccacagatgacatccttgtggcctcagcagagtgtcccagcgatgatgaggacatt
gacccctgtgagccgagctcaggtgggttagccaacccaacccgagcaggcggcagagag
ccgtatccaggctcagcagaagtgatccgggagtccagcagcaccacgggtatggtcgtt
gggatagtagccgctgccgccctgtgcatccttatcctcctctatgccatgtacaagtac
agaaaccgggatgaaggctcataccatgtggacgagagtcgaaactacatcagtaactca
gcacagtccaatggggctgttgtaaaggagaaacaacccagcagtgcgaaaagctccaac
aaaaataagaaaaacaaggataaagagtattatgtctga

DBGET integrated database retrieval system