KEGG   Homo sapiens (human): 9379Help
Entry
9379              CDS       T01001                                 

Gene name
NRXN2
Definition
(RefSeq) neurexin 2
  KO
K07377  
neurexin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    9379 (NRXN2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    9379 (NRXN2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  NLGN; neuroligin [KO:K07378]
   9379 (NRXN2)
  DAG1; dystroglycan 1 [KO:K06265]
   9379 (NRXN2)
  LRRTM1_2; leucine-rich repeat transmembrane neuronal protein 1/2 [KO:K16665]
   9379 (NRXN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13
AA seq 1712 aa AA seqDB search
MASGSRWRPTPPPLLLLLLLALAARADGLEFGGGPGQWARYARWAGAASSGELSFSLRTN
ATRALLLYLDDGGDCDFLELLLVDGRLRLRFTLSCAEPATLQLDTPVADDRWHMVLLTRD
ARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLA
NLKLGERPPALLGSQGLRGATADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKF
CSEEEHPMEGPAHLTLNSEVGSLLFSEGGAGRGGAGDVHQPTKGKEEFVATFKGNEFFCY
DLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEAL
VEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVNKLHYLVTISVDGILTTTGYTQEDYTM
LGSDDFFYIGGSPNTADLPGSPVSNNFMGCLKDVVYKNNDFKLELSRLAKEGDPKMKLQG
DLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGG
GAGSHSSAQRADYFAMELLDGHLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKG
SISVNSRSTPFLATGDSEILDLESELYLGGLPEGGRVDLPLPPEVWTAALRAGYVGCVRD
LFIDGRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGVCREGWNRFICDCIGTG
FLGRVCEREATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADT
LRLELDGGQMKLTVNLDCLRVGCAPSKGPETLFAGHKLNDNEWHTVRVVRRGKSLQLSVD
NVTVEGQMAGAHMRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGD
ITYCELNARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSG
NGNDFIVIELVKGYIHYVFDLGNGPSLMKGNSDKPVNDNQWHNVVVSRDPGNVHTLKIDS
RTVTQHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIA
DALHRIGQVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGTTYI
FGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTV
GVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERL
AIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKV
LALAAESDPNVRTEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTTRRG
RSPTLRDSTTQNTDDLLVASAECPSDDEDLEECEPSTGGELILPIITEDSLDPPPVATRS
PFVPPPPTFYPFLTGVGATQDTLPPPAARRPPSGGPCQAERDDSDCEEPIEASGFASGEV
FDSSLPPTDDEDFYTTFPLVTDRTTLLSPRKPAPRPNLRTDGATGAPGVLFAPSAPAPNL
PAGKMNHRDPLQPLLENPPLGPGAPTSFEPRRPPPLRPGVTSAPGFPHLPTANPTGPGER
GPPGAVEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNYISNS
AQSNGAVVKEKAPAAPKTPSKAKKNKDKEYYV
NT seq 5139 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgggagccggtggcggccgacaccgccgccgctgctgttgctgctgctgctg
gcgctggcggcgcgcgcggacggcctggagttcggcggcggccccgggcagtgggctcgc
tacgcgcgctgggcgggcgcggcgagcagcggcgagctcagcttcagcctgcgcaccaac
gccacgcgcgcgctgctgctctacctggacgacggcggcgactgcgacttcctggagctg
ctgctggtggacggccgcctgcggctgcgcttcacgctttcgtgcgccgagccggccacg
ctgcagctggacacgccggtggccgacgaccgctggcacatggtgctgctgacccgcgac
gcgcgccgcacggcgctggcggtggacggcgaggcccgcgccgccgaggtgcgctccaag
cggcgcgagatgcaggtggccagcgacctgttcgtgggcggcatcccgcccgacgtgcgc
ctctcggcgcttacgctgagcaccgtcaagtacgagccgcccttccgcggcctcttggcc
aacctgaagctgggcgagcggccccccgcgctgctgggcagccagggcctgcgcggcgcc
accgccgacccgctgtgcgcgcccgcgcgcaacccctgcgccaacggcggcctctgcacc
gtgctggcccccggcgaggtgggctgcgactgcagccacacgggcttcggcggcaagttc
tgcagcgaagaggagcaccccatggaaggtccggctcacctgacgttaaacagcgaagta
gggtccttactgttctccgaggggggggccgggagaggaggagccggcgatgtgcaccag
ccaacaaaaggcaaggaggagtttgtggcgaccttcaaaggcaatgagttcttctgctac
gacctgtcacacaaccccatccagagcagcactgatgagatcacactggccttccgcacc
ctgcaacgcaacggcctgatgctgcatacaggcaagtcggccgactacgtcaacctgtcc
ctcaagtctggggctgtctggctggtcatcaacctaggctcaggtgccttcgaggccctt
gtggaacccgtcaatggcaagttcaacgacaacgcctggcacgacgtccgggtcacccga
aacctgcgccagcacgcagggattggacacgctatggtaaacaaactgcattatctggtg
accatctcggtggacgggatcctgaccaccacaggctacacgcaggaggattacaccatg
ctgggctctgatgacttcttctacattgggggcagccccaacacagctgacctgccgggc
tcgcccgtcagcaacaacttcatgggctgcctcaaggacgtggtctataagaacaatgac
ttcaaattggaactatcccgcctggcaaaggaaggggaccccaagatgaagctgcagggg
gacttgtcattccgctgtgaggatgtggctgccctggaccctgtgacctttgagagtccc
gaggcctttgtggcgctgccccgctggagcgctaagcgcactggctccatctccctagac
ttccgcaccaccgagcccaatgggctgctgctcttcagccagggccggcgggctgggggt
ggagctggcagccacagctctgctcagcgggccgactactttgccatggagctattggac
ggccacctctatcttctgctggacatgggatctgggggcatcaagctgcgggcatccagc
cgcaaggtcaatgatggcgagtggtgtcacgtggacttccagagggatgggcgaaaaggc
tccatctcagtgaatagtcgcagcacgccgttcttggccactggagacagcgagattctg
gacctggagagtgagctgtacctgggcggtctccctgaggggggccgggtggacctgccc
ctgcccccagaggtgtggacagcagcactccgggcaggctacgtgggctgtgtgcgggac
ctcttcatagatgggcgtagccgagacctccggggcctggctgaggctcagggggctgtg
ggcgttgcccccttttgctcccgggagacgctgaagcagtgtgcatctgccccctgtcgc
aatgggggcgtctgtcgagaaggctggaaccgcttcatctgtgactgcatcgggaccggc
tttcttgggcgggtctgtgagagagaggccacggtcctgagctacgatggctccatgtac
atgaagatcatgctgcctaacgccatgcacacggaggcagaggatgtgtccctgcgtttc
atgtcccagcgggcctacggactcatgatggccaccacttccagggagtctgccgacacc
ctacgcctggagctggatggggggcagatgaagctcactgtcaacctcgactgcctgcgc
gtcggctgcgcacccagtaaaggccccgaaacgctgtttgcggggcacaagctcaatgac
aatgagtggcacacggtgagggtggtccggcgtggcaagagcctgcagctgtctgtggac
aacgtgactgtggagggacagatggcaggagcccatatgcggctggagttccacaacatt
gagacgggcatcatgacggagcggcggtttatctccgtggtgccctccaacttcatcggg
catctgagtgggctcgtgttcaatggccagccctacatggaccagtgcaaggatggtgac
atcacctactgtgagctcaatgctcgctttggcctgcgtgccatcgtggccgatcccgtc
accttcaagagtcgcagcagctacctggcactcgccacgctccaagcctatgcttccatg
cacctcttcttccagttcaagaccacggcccctgatgggcttcttctgttcaactcgggc
aacggcaatgacttcattgtcatcgagctggtcaaggggtacatccactacgtgtttgac
ctggggaatggcccgtccttgatgaaggggaactcagacaaaccagtcaatgacaaccag
tggcacaacgtggtggtgtccagggacccaggcaacgtgcacacgctcaagattgactcc
cgcactgtcacgcagcactccaatggcgcccgaaacctcgatctcaaaggggagttgtac
attggcggtctgagcaagaatatgttcagcaacctgcccaagctggtggcctcccgggat
ggctttcagggctgcctggcctcagtggacctcaacggacgtctcccagacctcatcgcc
gacgccctgcaccgcattgggcaggtggagaggggctgtgatggccccagcaccacctgc
actgaagagtcctgtgccaaccagggcgtctgcttgcagcagtgggatggcttcacctgc
gactgcaccatgacttcctatggaggccctgtctgcaatgatcccgggaccacatacatc
tttgggaaggggggagcgctcatcacctacacgtggccccccaatgacaggcccagcacg
aggatggatcgcctggccgtgggcttcagcacccaccagcggagcgctgtgctggtgcgg
gtggacagcgcctccggccttggagactacctgcagctgcacatcgaccagggcaccgtg
ggggtgatctttaacgtgggcacggacgacattaccatcgacgagcccaacgccatagta
agcgacggcaaataccacgtggtgcgcttcactcgaagcggcggcaacgccaccctgcag
gtggacagctggccggtcaacgagcggtacccggcaggaaactttgataacgagcgcctg
gcgattgctagacagagaatcccctaccggcttggtcgagtagtagatgagtggctgctc
gacaaaggccgccagctgaccatcttcaacagccaggctgccatcaagatcgggggccgg
gatcagggccgccccttccagggccaggtgtccggcctctactacaatgggctcaaggtg
ctggcgctggccgccgagagcgaccccaatgtgcggactgagggtcacctgcgcctggtg
ggggaggggccgtccgtgctgctcagtgcggagaccacggccaccaccctgctggctgac
atggccaccaccatcatggagactaccaccaccatggccactaccaccacgcgccggggc
cgctcccccacactgagggacagcaccacccagaacacagatgacctgctggtggcctct
gctgagtgtccaagcgatgatgaggacctggaggagtgtgagcccagtactggaggagag
ttaatattgcccattatcacggaggactccttagacccccctcccgtggccacccgatcc
cccttcgtgcccccgccccctaccttctaccccttcctcacgggagtgggcgccacccaa
gacacgctgcccccgcccgccgcgcgccgcccgccctctgggggcccgtgccaggccgag
cgggacgacagcgactgcgaggagcccatcgaggcctcgggcttcgcctccggggaggtc
tttgactccagcctcccccccacggacgacgaggacttttacaccacctttcccctggtc
acggaccgcaccaccctcctgtcaccccgcaaacccgctccccggcccaacctcaggaca
gatggggccacgggcgcccctggggtgctgtttgccccctccgccccggcccccaacctg
ccggcgggcaaaatgaaccaccgagacccgcttcagcccttgctggagaacccgcccttg
gggcccggggcccccacgtcctttgagccgcggaggccccctcccctgcgccccggcgtg
acctcagcccccggcttcccccatctgcccacagccaaccccacagggcctggggagcgg
ggcccgccgggcgcagtggaggtgatccgggagtccagcagcaccacgggcatggtggtg
ggcattgtggcggcggcggcgctctgcatcctcatcctcctctacgccatgtataagtac
cgcaatcgtgatgagggctcctaccaggtggaccagagccgaaactacatcagtaactcg
gcccagagcaatggggcggtggtgaaagagaaggccccggctgcccccaagacgcccagc
aaggccaagaagaacaaagacaaggagtattatgtctga

DBGET integrated database retrieval system