KEGG   Homo sapiens (human): 9388Help
Entry
9388              CDS       T01001                                 

Gene name
LIPG, EDL, EL, PRO719
Definition
(RefSeq) lipase G, endothelial type (EC:3.1.1.3)
  KO
K01046  
triacylglycerol lipase [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    9388 (LIPG)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     9388 (LIPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
18q21.1
AA seq 500 aa AA seqDB search
MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPE
HEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVV
VDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGN
FVKGTVGRITGLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHID
IYPNGGDFQPGCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
NRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQMKIHVFSYKN
MGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQLTWEGAS
QSWYNLWKEFRSYLSQPRNPGRELNIRRIRVKSGETQRKLTFCTEDPENTSISPGRELWF
RKCRDGWRMKNETSPTVELP
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactccgttcctctgctctgtttctggagcctctgctattgctttgctgcgggg
agccccgtaccttttggtccagagggacggctggaagataagctccacaaacccaaagct
acacagactgaggtcaaaccatctgtgaggtttaacctccgcacctccaaggacccagag
catgaaggatgctacctctccgtcggccacagccagcccttagaagactgcagtttcaac
atgacagctaaaacctttttcatcattcacggatggacgatgagcggtatctttgaaaac
tggctgcacaaactcgtgtcagccctgcacacaagagagaaagacgccaatgtagttgtg
gttgactggctccccctggcccaccagctttacacggatgcggtcaataataccagggtg
gtgggacacagcattgccaggatgctcgactggctgcaggagaaggacgatttttctctc
gggaatgtccacttgatcggctacagcctcggagcgcacgtggccgggtatgcaggcaac
ttcgtgaaaggaacggtgggccgaatcacaggtttggatcctgccgggcccatgtttgaa
ggggccgacatccacaagaggctctctccggacgatgcagattttgtggatgtcctccac
acctacacgcgttccttcggcttgagcattggtattcagatgcctgtgggccacattgac
atctaccccaatgggggtgacttccagccaggctgtggactcaacgatgtcttgggatca
attgcatatggaacaatcacagaggtggtaaaatgtgagcatgagcgagccgtccacctc
tttgttgactctctggtgaatcaggacaagccgagttttgccttccagtgcactgactcc
aatcgcttcaaaaaggggatctgtctgagctgccgcaagaaccgttgtaatagcattggc
tacaatgccaagaaaatgaggaacaagaggaacagcaaaatgtacctaaaaacccgggca
ggcatgcctttcagagtttaccattatcagatgaaaatccatgtcttcagttacaagaac
atgggagaaattgagcccaccttttacgtcaccctttatggcactaatgcagattcccag
actctgccactggaaatagtggagcggatcgagcagaatgccaccaacaccttcctggtc
tacaccgaggaggacttgggagacctcttgaagatccagctcacctgggagggggcctct
cagtcttggtacaacctgtggaaggagtttcgcagctacctgtctcaaccccgcaacccc
ggacgggagctgaatatcaggcgcatccgggtgaagtctggggaaacccagcggaaactg
acattttgtacagaagaccctgagaacaccagcatatccccaggccgggagctctggttt
cgcaagtgtcgggatggctggaggatgaaaaacgaaaccagtcccactgtggagcttccc
tga

DBGET integrated database retrieval system