KEGG   Homo sapiens (human): 9394Help
Entry
9394              CDS       T01001                                 

Gene name
HS6ST1, HH15, HS6ST
Definition
heparan sulfate 6-O-sulfotransferase 1 (EC:2.8.2.-)
Orthology
K02514  
heparan sulfate 6-O-sulfotransferase HS6ST1 [EC:2.8.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan biosynthesis - heparan sulfate / heparin [PATH:hsa00534]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q21
AA seq 411 aa AA seqDB search
MRRRRAGGRTMVERASKFVLVVAGSVCFMLILYQYAGPGLSLGAPGGRAPPDDLDLFPTP
DPHYEKKYYFPVRELERSLRFDMKGDDVIVFLHIQKTGGTTFGRHLVQNVRLEVPCDCRP
GQKKCTCYRPNRRETWLFSRFSTGWSCGLHADWTELTNCVPGVLDRRDSAALRTPRKFYY
ITLLRDPVSRYLSEWRHVQRGATWKTSLHMCDGRTPTPEELPPCYEGTDWSGCTLQEFMD
CPYNLANNRQVRMLADLSLVGCYNLSFIPEGKRAQLLLESAKKNLRGMAFFGLTEFQRKT
QYLFERTFNLKFIRPFMQYNSTRAGGVEVDEDTIRRIEELNDLDMQLYDYAKDLFQQRYQ
YKRQLERREQRLRSREERLLHRAKEALPREDADEPGRVPTEDYMSHIIEKW
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcggcggcggcgcgccggcggcaggaccatggttgagcgcgccagcaagttcgtgctg
gtggtggcgggctcggtgtgcttcatgctcatcttgtaccagtacgcgggcccaggactg
agcctgggcgcgcccggcggccgcgcgccgcccgacgacctggacctgttccccacaccc
gacccccactacgagaagaagtactacttcccggtccgcgagctggagcgctcgctgcgc
ttcgacatgaagggcgacgacgtgatcgtcttcctgcacatccagaagacgggcggcacc
accttcggccgccacctcgtgcagaacgtacgcctcgaggtgccgtgcgactgccggccc
ggccagaagaagtgcacctgctaccggcccaaccgccgcgagacttggctcttctcccgc
ttctccaccggctggagctgcgggctgcacgccgactggaccgagctcaccaactgcgtg
cccggcgtgctggaccgccgcgactccgccgcgctgcgcacgcccaggaagttctactac
atcaccctgctacgagaccccgtgtcccgctacctgagcgagtggcggcatgtgcagagg
ggtgccacgtggaagacgtcgttgcatatgtgtgatgggcgcacgcccacgcctgaggag
ctgccgccctgctacgagggcacggactggtcgggctgcacgctacaggagttcatggac
tgcccgtacaacctggccaacaaccgccaggtgcgcatgctggccgacctgagcctggtg
ggctgctacaacctgtccttcatccccgagggcaagcgggcccagctgctgctcgagagc
gccaagaagaacctgcggggcatggccttcttcggcctgaccgagttccagcgcaagacg
cagtacctgttcgagcggacgttcaacctcaagttcatccggcccttcatgcagtacaat
agcacgcgggcgggcggcgtggaggtggatgaagacaccatccggcgcatcgaggagctc
aacgacctggacatgcagctgtacgactacgccaaggacctcttccagcagcgctaccag
tacaagcggcagctggagcgcagggagcagcgcctgaggagccgcgaggagcgtctgctg
caccgggccaaggaggcactgccgcgggaggatgccgacgagccgggccgcgtgcccacc
gaggactacatgagccacatcattgagaagtggtag

DBGET integrated database retrieval system