KEGG   Homo sapiens (human): 94026Help
Entry
94026             CDS       T01001                                 

Gene name
POM121L2, POM121-L, POM121L
Definition
POM121 transmembrane nucleoporin-like 2
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    94026 (POM121L2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     94026 (POM121L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
6p22.1
AA seq 1035 aa AA seqDB search
MGSFLSKLELSPSSPAQVRTDLPERPTKRRPPQPLHQVHRVQFVHRAHPAPRYRPVRRRP
NLDPANPTTWLANEAWRRFPMKKSQNSPLGPLPSDWWESYLKRTIWSLRHPRPIWSPVTI
RITPPDQRVPPSTSPEDVIALAGLPPSEELADPCSKETVLRALRECRKGKGRLEEPLFPE
SLDSKRRSPETRPSAFKPLMKNGTLTSFVPRPGPLKRSLHSWGSDHSLTKRPNCSSMSSL
ASIYRGGTLSSKRNAIGSSYSSCRNFSDPWKRSVPSVSFETPEWPIKKEKSCHRPSSPVP
LVSDFESLGGSESSGQQNQKIPQLPSSPENLVSEIPPPQLGYAVSDENLTLGKKAELQVS
NNAGEDTTEVNTDPFPETWLAIQPSLSLALPSSETDLTQGANPQLENLRKMQKSLGPLAS
PQSTGEATSVAHSPLKTPSLPTPPGCSQSELLPGTSPDSKPTATFILLTPTSPTLPVTDT
TWPPSTSQADRSPMPPDPPAPPTIQSTLLGMVSSPTSHLSASAPPDATSAHLMLKPILGP
LHNSEIGSSSYSRISVTAAASSISSLSTIQGTLTPTFKPIFGSIDPLKTTPMIAPFSSKQ
TPPPFTHASTHHFHGLVKATSVVMSTTLASTSKDSVFKPPLDFGVVNVTSAVGNTYSVPS
TCDTFLLGTAQAFRADFTPATGFIFPPHHHPTIPTVHTVTMFTQVLSSVVQISPRSSTAN
FRGMGSPLPASALVSTNWLASTPSISNLTPAITSPLGSSSRPPFPLSQGANPQPAFGATN
GQKQGPSQPALMPSVSSSFLFGSSAVALPTPMPTPAQPAFISTTQSALGCLTPSASTSQT
PASTWSGIGGIPAGFPISQASTTGFRIVIQTHQSGAFGSVFGSRAPQPFTFGGFVTPMDC
DESGIIMTGPDMSPTSGAFSIGALPSGTTNTMIPFGKGWSQNTEGLPSHRTAFSLGRGSI
SARKTMAPIAQNTPVPGQAKAGSSVGFGMPFPPAQGSVGRGPFRSSASSFSIGAKSKTPK
NREKGHSRRHHAYKK
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtttcctgagcaaactggaactttcgccctcgtccccagcccaggtgcgcacc
gacttgcccgagaggcccacgaaacgccggccacctcagccccttcaccaagttcatcgg
gttcagttcgtccaccgcgcccaccctgccccacggtatagacctgtgaggaggcggcca
aacctggatcctgccaatccaaccacgtggctggccaacgaggcctggaggcgctttccc
atgaagaagtcccagaattcccccctggggcctctcccttcagactggtgggaaagttac
ttaaagcggactatttggtctcttcgacatcccaggccaatttggagcccagtgaccatc
aggatcactcctcctgaccagagagtgcccccttccacttctcctgaagatgtaattgcc
cttgcaggactcccgccctctgaggagctcgcagatccatgttcaaaggagacagtgttg
agggccctcagagagtgcagaaaagggaaagggaggttggaagaaccactattccctgag
agtctggacagtaagagaaggagtccagagaccagaccatcggcatttaagcccctgatg
aaaaatggaaccctcacttcttttgtgcccaggcctgggccgctgaagagaagtctccac
tcctggggctcagatcacagcttgactaagaggcccaattgctcctccatgagctccttg
gccagcatatacagaggtggcaccctcagctccaaaaggaatgctattggcagctcttac
agctcttgcagaaatttctcagacccttggaagagaagtgttcccagtgtatcattcgag
acaccagagtggccaataaaaaaggaaaaaagttgtcatcggccttcctctccagtccca
ctggtatcagattttgagtccctaggaggatctgaaagttctgggcagcaaaaccagaag
attccacagctgccgtctagccctgagaacctggtgtcagagatcccacctccccagctt
ggttatgcagtctctgatgagaacttgactttggggaagaaagctgagctacaggtaagc
aacaacgcaggagaagatacaactgaggtcaacacagaccctttccctgagacttggctt
gctattcagccttccttgtctcttgctctgccttcttcagaaacagatctaacccaggga
gcaaatcctcagttggaaaacttaagaaaaatgcagaagtctctaggtccactggcctct
ccacagtccacgggagaggcaaccagtgtggcccattctcctttgaagacacccagccta
ccgaccccacctgggtgctcacagtcagagctccttccaggcacctctccagactcaaag
cccacagctactttcatcctgctgacccccacctctcccacattaccagttactgacacc
acctggccgccttcaacctctcaggctgacaggtctcccatgcccccagacccacctgca
ccacccaccatccaaagtactttgcttggaatggtgagtagcccaacatcccatctttct
gcatctgcacctcctgatgcaacttctgctcacctcatgttaaaaccgattttggggccc
ctgcacaacagcgagattggaagctcctcatattccagaatttcagtcacagctgcagca
tcttcaatctcttccctttccacaattcagggtaccttaactcctaccttcaagcctatc
tttggcagcatagatccacttaaaactacgcccatgatagctcctttctcctccaagcag
acccctcctccatttactcatgcttctacccatcatttccatggcctggtcaaggccacc
tctgtggtcatgtccaccaccctagccagcacatctaaagactctgtttttaagccacct
ttggattttggtgtagtgaatgtcaccagtgccgtaggcaacacttattctgtcccttcc
acttgcgacactttcctgcttgggactgctcaggccttcagggccgacttcaccccagcc
acaggattcattttcccaccacaccaccatcctacaattcctactgtgcatacagtcacc
atgtttacccaggtcctttccagtgttgtacagatatcccctagaagcagcactgctaat
ttcaggggtatgggcagccctctgcctgcctctgccctagtatccacaaactggcttgca
tcaacccccagcatctccaacctgactccagcaatcacaagtcccttgggatcaagctca
aggccacctttcccactatcccaaggagctaatccccagcctgcatttggtgccacaaat
ggacagaaacaagggccttcccagccagcccttatgccaagtgtcagtagttcttttctt
tttgggagctcagcagtggcattgccaacccccatgccaactccagctcagccagccttc
attagtaccacacagtcagccttggggtgtttgacaccctcagcctccacctctcaaacc
cctgccagcacctggtcaggcattggcggcattccagcaggttttcccattagtcaagct
agtacaactgggtttagaattgtaattcagacccaccaaagtggggcttttggctcagtg
tttggcagcagagctccacaacctttcacttttgggggattcgtgacccctatggactgt
gatgagtctgggatcataatgactggtccagacatgagccccacctctggagctttcagc
attggagcattgcctagtgggaccactaacaccatgatcccctttggaaaaggctggagc
cagaacactgaaggcctgcccagccaccgcacagctttttccttggggagaggcagcatt
tctgcaagaaagactatggcccccattgctcaaaacaccccagtccctggacaagctaag
gcaggcagcagtgttggctttgggatgccttttccacctgcccagggctctgttgggaga
ggaccttttagatcatcagcctcttcattttccattggcgcaaaatcaaaaaccccaaag
aatcgggagaaagggcattcccgaaggcatcatgcctacaagaagtag

DBGET integrated database retrieval system