KEGG   Homo sapiens (human): 9410Help
Entry
9410              CDS       T01001                                 

Gene name
SNRNP40, 40K, HPRP8BP, PRP8BP, PRPF8BP, SPF38, WDR57
Definition
small nuclear ribonucleoprotein 40kDa (U5)
Orthology
K12857  
Prp8 binding protein
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U4/U6.U5 tri-snRNP
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    9410 (SNRNP40)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    9410 (SNRNP40)
 Complex C
   U5 SnRNP specific factors
    9410 (SNRNP40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p35.2
AA seq 357 aa AA seqDB search
MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIM
LLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTD
GSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWD
IRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTG
LSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKI
AAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgatagaacagcagaagcgtaagggcccagagttgccgctggttccagtcaagcggcag
cggcatgagttgctgttgggagcggggtctggcccaggagccgggcagcagcaggcgacg
ccgggagccttgctgcaagcgggacctccaagatgttcctcccttcaagccccaatcatg
ctgctctctggacatgaaggggaagtctactgctgcaagttccaccccaacggatccacc
ttagcatctgcaggatttgaccgactgatattactgtggaatgtctatggtgactgtgat
aactatgccacactgaagggacacagtggagcagtgatggaattgcattacaacacagat
ggcagtatgcttttctcagcatccacagataaaaccgtggctgtgtgggatagtgaaaca
ggtgagagggttaaaaggctaaagggacatacttcctttgtgaattcctgttatccagcc
aggagaggccctcagcttgtctgcactggcagtgacgatggcacagttaagctttgggac
atccggaagaaagcagccatccagacatttcagaacacgtaccaggtgttagctgtgacc
ttcaatgacacaagtgatcagattatttctggtggaatagacaatgatatcaaggtctgg
gacctgcgccagaacaagctaacctacaccatgagaggccatgcagattcagtgactggc
ctgagtttaagttctgaaggctcttatcttttgtccaatgcaatggacaatacagttcgt
gtctgggatgtccggccatttgcccccaaagagagatgtgtaaagatatttcaaggaaat
gtgcacaactttgaaaagaaccttctgagatgttcttggtcacctgatggaagcaaaata
gcagctggctcagccgacaggtttgtttatgtgtgggataccacaagcaggagaatattg
tataagctgcccggccatgctggctccatcaatgaagtggctttccaccctgatgagccc
atcattatctcagcatcgagtgacaagagactgtatatgggagagattcagtga

DBGET integrated database retrieval system