KEGG   Homo sapiens (human): 9415Help
Entry
9415              CDS       T01001                                 

Gene name
FADS2, D6D, DES6, FADSD6, LLCDL2, SLL0262, TU13
Definition
fatty acid desaturase 2 (EC:1.14.19.-)
Orthology
K10226  
fatty acid desaturase 2 (delta-6 desaturase) [EC:1.14.19.-]
Organism
hsa  Homo sapiens (human)
Pathway
alpha-Linolenic acid metabolism
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    9415 (FADS2)
  Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    9415 (FADS2)
   01040 Biosynthesis of unsaturated fatty acids
    9415 (FADS2)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    9415 (FADS2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.-  
     9415 (FADS2)
Lipid biosynthesis proteins [BR:hsa01004]
 Desaturase
  Front-end
   9415 (FADS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.2
AA seq 422 aa AA seqDB search
MHGREAGPFVCVCVLLASIPTPQTPLLQASLPPFHPASAGHPITGQQDAFRAFHPDLEFV
GKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNHVFFLLLLAHIIA
LESIAWFTVFYFGNGWIPTLITAFVLATSQAQAGWLQHDYGHLSVYRKPKWNHLVHKFVI
GHLKGASANWWNHRHFQHHAKPNIFHKDPDVNMLHVFVLGEWQPIEYGKKKLKYLPYNHQ
HEYFFLIGPPLLIPMYFQYQIIMTMIVHKNWVDLAWAVSYYIRFFITYIPFYGILGALLF
LNFIRFLESHWFVWVTQMNHIVMEIDQEAYRDWFSSQLTATCNVEQSFFNDWFSGHLNFQ
IEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLLRALLDIIRSLKKSGKLWLDAYL
HK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcacggcagggaggcgggaccctttgtttgtgtgtgcgtgttgttggcctccatcccc
actccccagactccacttctccaggcctctctcccgccttttcatcccgcatccgcagga
cacccaatcaccgggcaacaggatgccttccgcgccttccaccctgacctggaattcgtg
ggcaagttcttgaaacccctgctgattggtgaactggccccggaggagcccagccaggac
cacggcaagaactcaaagatcactgaggacttccgggccctgaggaagacggctgaggac
atgaacctgttcaagaccaaccacgtgttcttcctcctcctcctggcccacatcatcgcc
ctggagagcattgcatggttcactgtcttttactttggcaatggctggattcctaccctc
atcacggcctttgtccttgctacctctcaggcccaagctggatggctgcaacatgattat
ggccacctgtctgtctacagaaaacccaagtggaaccaccttgtccacaaattcgtcatt
ggccacttaaagggtgcctctgccaactggtggaatcatcgccacttccagcaccacgcc
aagcctaacatcttccacaaggatcccgatgtgaacatgctgcacgtgtttgttctgggc
gaatggcagcccatcgagtacggcaagaagaagctgaaatacctgccctacaatcaccag
cacgaatacttcttcctgattgggccgccgctgctcatccccatgtatttccagtaccag
atcatcatgaccatgatcgtccataagaactgggtggacctggcctgggccgtcagctac
tacatccggttcttcatcacctacatccctttctacggcatcctgggagccctccttttc
ctcaacttcatcaggttcctggagagccactggtttgtgtgggtcacacagatgaatcac
atcgtcatggagattgaccaggaggcctaccgtgactggttcagtagccagctgacagcc
acctgcaacgtggagcagtccttcttcaacgactggttcagtggacaccttaacttccag
attgagcaccacctcttccccaccatgccccggcacaacttacacaagatcgccccgctg
gtgaagtctctatgtgccaagcatggcattgaataccaggagaagccgctactgagggcc
ctgctggacatcatcaggtccctgaagaagtctgggaagctgtggctggacgcctacctt
cacaaatga

DBGET integrated database retrieval system