KEGG   Homo sapiens (human): 9415Help
Entry
9415              CDS       T01001                                 

Gene name
FADS2, D6D, DES6, FADSD6, LLCDL2, SLL0262, TU13
Definition
fatty acid desaturase 2 (EC:1.14.19.-)
Orthology
K10226  
fatty acid desaturase 2 (delta-6 desaturase) [EC:1.14.19.-]
Organism
hsa  Homo sapiens (human)
Pathway
alpha-Linolenic acid metabolism
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:hsa01212]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:hsa00592]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:hsa01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.2
AA seq 422 aa AA seqDB search
MHGREAGPFVCVCVLLASIPTPQTPLLQASLPPFHPASAGHPITGQQDAFRAFHPDLEFV
GKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNHVFFLLLLAHIIA
LESIAWFTVFYFGNGWIPTLITAFVLATSQAQAGWLQHDYGHLSVYRKPKWNHLVHKFVI
GHLKGASANWWNHRHFQHHAKPNIFHKDPDVNMLHVFVLGEWQPIEYGKKKLKYLPYNHQ
HEYFFLIGPPLLIPMYFQYQIIMTMIVHKNWVDLAWAVSYYIRFFITYIPFYGILGALLF
LNFIRFLESHWFVWVTQMNHIVMEIDQEAYRDWFSSQLTATCNVEQSFFNDWFSGHLNFQ
IEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLLRALLDIIRSLKKSGKLWLDAYL
HK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcacggcagggaggcgggaccctttgtttgtgtgtgcgtgttgttggcctccatcccc
actccccagactccacttctccaggcctctctcccgccttttcatcccgcatccgcagga
cacccaatcaccgggcaacaggatgccttccgcgccttccaccctgacctggaattcgtg
ggcaagttcttgaaacccctgctgattggtgaactggccccggaggagcccagccaggac
cacggcaagaactcaaagatcactgaggacttccgggccctgaggaagacggctgaggac
atgaacctgttcaagaccaaccacgtgttcttcctcctcctcctggcccacatcatcgcc
ctggagagcattgcatggttcactgtcttttactttggcaatggctggattcctaccctc
atcacggcctttgtccttgctacctctcaggcccaagctggatggctgcaacatgattat
ggccacctgtctgtctacagaaaacccaagtggaaccaccttgtccacaaattcgtcatt
ggccacttaaagggtgcctctgccaactggtggaatcatcgccacttccagcaccacgcc
aagcctaacatcttccacaaggatcccgatgtgaacatgctgcacgtgtttgttctgggc
gaatggcagcccatcgagtacggcaagaagaagctgaaatacctgccctacaatcaccag
cacgaatacttcttcctgattgggccgccgctgctcatccccatgtatttccagtaccag
atcatcatgaccatgatcgtccataagaactgggtggacctggcctgggccgtcagctac
tacatccggttcttcatcacctacatccctttctacggcatcctgggagccctccttttc
ctcaacttcatcaggttcctggagagccactggtttgtgtgggtcacacagatgaatcac
atcgtcatggagattgaccaggaggcctaccgtgactggttcagtagccagctgacagcc
acctgcaacgtggagcagtccttcttcaacgactggttcagtggacaccttaacttccag
attgagcaccacctcttccccaccatgccccggcacaacttacacaagatcgccccgctg
gtgaagtctctatgtgccaagcatggcattgaataccaggagaagccgctactgagggcc
ctgctggacatcatcaggtccctgaagaagtctgggaagctgtggctggacgcctacctt
cacaaatga

DBGET integrated database retrieval system