KEGG   Homo sapiens (human): 94160Help
Entry
94160             CDS       T01001                                 

Gene name
ABCC12, MRP9
Definition
(RefSeq) ATP binding cassette subfamily C member 12
  KO
K05672  ATP-binding cassette, subfamily C (CFTR/MRP), member 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    94160 (ABCC12)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    94160 (ABCC12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N RsgA_GTPase AAA_29 T2SSE AAA_16 MMR_HSR1 AAA_23 AAA_22 Dynamin_N DUF87 Zeta_toxin cobW
Motif
Other DBs
NCBI-GeneID: 94160
NCBI-ProteinID: NP_150229
OMIM: 607041
HGNC: 14640
Ensembl: ENSG00000140798
Vega: OTTHUMG00000133143
Pharos: Q96J65(Tbio)
UniProt: Q96J65
Position
16q12.1
AA seq 1359 aa AA seqDB search
MVGEGPYLISDLDQRGRRRSFAERYDPSLKTMIPVRPCARLAPNPVDDAGLLSFATFSWL
TPVMVKGYRQRLTVDTLPPLSTYDSSDTNAKRFRVLWDEEVARVGPEKASLSHVVWKFQR
TRVLMDIVANILCIIMAAIGPVILIHQILQQTERTSGKVWVGIGLCIALFATEFTKVFFW
ALAWAINYRTAIRLKVALSTLVFENLVSFKTLTHISVGEVLNILSSDSYSLFEAALFCPL
PATIPILMVFCAAYAFFILGPTALIGISVYVIFIPVQMFMAKLNSAFRRSAILVTDKRVQ
TMNEFLTCIRLIKMYAWEKSFTNTIQDIRRRERKLLEKAGFVQSGNSALAPIVSTIAIVL
TLSCHILLRRKLTAPVAFSVIAMFNVMKFSIAILPFSIKAMAEANVSLRRMKKILIDKSP
PSYITQPEDPDTVLLLANATLTWEHEASRKSTPKKLQNQKRHLCKKQRSEAYSERSPPAK
GATGPEEQSDSLKSVLHSISFVVRKGKILGICGNVGSGKSSLLAALLGQMQLQKGVVAVN
GTLAYVSQQAWIFHGNVRENILFGEKYDHQRYQHTVRVCGLQKDLSNLPYGDLTEIGERG
LNLSGGQRQRISLARAVYSDRQLYLLDDPLSAVDAHVGKHVFEECIKKTLRGKTVVLVTH
QLQFLESCDEVILLEDGEICEKGTHKELMEERGRYAKLIHNLRGLQFKDPEHLYNAAMVE
AFKESPAEREEDAGIIVLAPGNEKDEGKESETGSEFVDTKVPEHQLIQTESPQEGTVTWK
TYHTYIKASGGYLLSLFTVFLFLLMIGSAAFSNWWLGLWLDKGSRMTCGPQGNRTMCEVG
AVLADIGQHVYQWVYTASMVFMLVFGVTKGFVFTKTTLMASSSLHDTVFDKILKSPMSFF
DTTPTGRLMNRFSKDMDELDVRLPFHAENFLQQFFMVVFILVILAAVFPAVLLVVASLAV
GFFILLRIFHRGVQELKKVENVSRSPWFTHITSSMQGLGIIHAYGKKESCITYHLLYFNC
ALRWFALRMDVLMNILTFTVALLVTLSFSSISTSSKGLSLSYIIQLSGLLQVCVRTGTET
QAKFTSVELLREYISTCVPECTHPLKVGTCPKDWPSRGEITFRDYQMRYRDNTPLVLDSL
NLNIQSGQTVGIVGRTGSGKSSLGMALFRLVEPASGTIFIDEVDICILSLEDLRTKLTVI
PQDPVLFVGTVRYNLDPFESHTDEMLWQVLERTFMRDTIMKLPEKLQAEVTENGENFSVG
ERQLLCVARALLRNSKIILLDEATASMDSKTDTLVQNTIKDAFKGCTVLTIAHRLNTVLN
CDHVLVMENGKVIEFDKPEVLAEKPDSAFAMLLAAEVRL
NT seq 4080 nt NT seq  +upstreamnt  +downstreamnt
atggtgggtgaaggaccctaccttatctcagatctggaccagcgaggccggcggagatcc
tttgcagaaagatatgaccccagcctgaagaccatgatcccagtgcgaccctgtgcaagg
ttagcacccaacccggtggatgatgccgggctactctccttcgccacattttcctggctc
acgccggtgatggtgaaaggctaccggcaaaggctgaccgtagacaccctgcccccattg
tcgacatatgactcatctgacaccaatgccaaaagatttcgagtcctttgggatgaagag
gtagcaagggtgggtcctgagaaggcctctctgagccacgtggtgtggaaattccagagg
acacgcgtgttgatggacatcgtggccaacatcctgtgcatcatcatggcagccataggg
ccggtgattctcattcaccaaatcctccagcagactgagaggacctctgggaaagtctgg
gttggcattggactgtgcatagccctttttgccaccgagtttaccaaagtcttcttttgg
gcccttgcctgggccatcaactaccgcacggccatccggttgaaggtggcgctctccacc
ttggtttttgaaaacctagtgtccttcaagacattgacccacatctctgttggcgaggtg
ctcaatatactgtcaagtgatagctattctttgtttgaagctgccttgttttgtcctttg
ccagccaccatcccgatcctaatggtcttttgtgcggcgtacgcctttttcattctgggg
cccacagctctcatcgggatatcagtgtatgtcatattcatacccgtccagatgtttatg
gccaagctcaattcagctttccgaaggtcagcaattttggtgacagacaagcgagttcag
acaatgaatgagtttctgacctgcatcaggctgatcaaaatgtatgcctgggagaaatct
tttaccaacactatccaagatataagaaggagggaaagaaaattactggaaaaagctgga
tttgtccaaagtggaaactctgccctggcccccatcgtgtccaccatagccatcgtgctg
acattatcctgccacatcctcctgagacgcaaactcaccgcacccgtggcatttagtgtg
attgccatgtttaatgtaatgaagttttccattgcaatcttgcccttctccatcaaagca
atggctgaagcgaatgtctctctaaggagaatgaagaaaattctcatagataaaagcccc
ccatcttacatcacccaaccagaagacccagatactgtcttgcttttagcaaatgccacc
ttgacatgggagcatgaagccagcaggaaaagtaccccaaagaaattgcagaaccagaaa
aggcatttatgcaagaaacagaggtcagaggcatacagtgagaggagtccaccagccaag
ggagccactggcccagaggagcaaagtgacagcctcaaatcggttctgcacagcataagc
tttgtggtgagaaaggggaagatcttgggaatatgtgggaatgtgggaagtggaaagagc
tccctccttgcagctctcctaggacagatgcagctgcagaaaggggtggtggcagtcaat
ggaactttggcctacgtttcacagcaggcatggatctttcatggaaatgtgagagaaaac
atactctttggagaaaagtatgatcaccaaaggtatcagcacacagtccgcgtctgtggc
ctccagaaggacctgagcaacctcccctatggagacctgactgagattggggagcggggc
ctcaacctctctggggggcagaggcagaggattagcctggcccgcgctgtctactccgac
cgtcagctctacctgctggacgaccccctgtcggccgtggacgcccacgtggggaagcac
gtctttgaggagtgcattaagaagacgctcaggggaaagacagtcgtcctggtgacccac
cagctacagttcttagagtcttgtgatgaagttattttattagaagatggagagatttgt
gaaaagggaacccacaaggagttaatggaggagagagggcgctatgcaaaactgattcac
aacctgcgaggattgcagttcaaggatcctgaacacctttacaatgcagcaatggtggaa
gccttcaaggagagccctgctgagagagaggaagatgctggtataatcgttttggctcca
ggaaatgagaaagatgaaggaaaagaatctgaaacaggctcagaatttgtagacacaaaa
gttcctgagcaccagctcatccagactgaatccccccaggaaggaaccgtgacctggaaa
acatatcacacgtacattaaggcttctggagggtacctcctttctctcttcactgtgttc
ctcttcctcctgatgattggcagcgctgccttcagcaactggtggctgggtctctggttg
gacaagggctcacggatgacctgtgggccccagggcaacaggaccatgtgtgaggtcggc
gcggtgctggcagacatcggtcagcatgtgtaccagtgggtgtacactgcaagcatggtg
ttcatgctggtgtttggcgtcaccaaaggcttcgtcttcaccaagaccacactgatggca
tcctcctctctgcatgacacggtgtttgataagatcttaaagagcccaatgagtttcttt
gacacgactcccactggcaggctaatgaaccgtttttccaaggatatggacgagctggat
gtgaggctgccgtttcacgcagagaactttctgcagcagttttttatggtggtgtttatt
ctcgtgatcttggctgctgtgtttcctgctgtccttttagtcgtggccagccttgctgta
ggcttcttcattctgttacgcattttccacagaggagtccaggagctcaagaaggtggag
aatgtcagccggtcaccctggttcacccacatcacctcctccatgcagggcctgggcatc
attcacgcctatggcaagaaggagagctgcatcacctatcacctcctctactttaactgt
gctctcaggtggtttgcgctgagaatggatgtcctcatgaacatccttaccttcactgtg
gccttgttggtgaccctgagtttctcctccatcagtacttcatccaaaggcctgtcattg
tcatacatcatccagctgagcggactgctccaagtgtgtgtgcgaacgggaacagagacg
caagccaaattcacctccgtggagctgctcagggaatacatttcgacctgtgttcctgaa
tgcactcatcccctcaaagtggggacctgtcccaaggactggcccagccgtggggagatc
accttcagagactatcagatgagatacagagacaacaccccccttgttctcgacagcctg
aacttgaacatacaaagtgggcagacagtcgggattgttggaagaacaggttccggaaag
tcatcgttaggaatggctttgtttcgtctggtggagccagccagtggcacaatctttatt
gatgaggtggatatctgcattctcagcttggaagacctcagaaccaagctgactgtgatc
ccacaggatcctgtcctgtttgtaggtacagtaaggtacaacttggatccctttgagagt
cacaccgatgagatgctctggcaggttctggagagaacattcatgagagacacaataatg
aaactcccagaaaaattacaggcagaagtcacagaaaatggagaaaacttctcagtaggg
gaacgtcagctgctttgtgtggcccgagctcttctccgtaattcaaagatcattctcctt
gatgaagccaccgcctctatggactccaagactgacaccctggttcagaacaccatcaaa
gatgccttcaagggctgcactgtgctgaccatcgcccaccgcctcaacacagttctcaac
tgcgatcacgtcctggttatggaaaatgggaaggtgattgagtttgacaagcctgaagtc
cttgcagagaagccagattctgcatttgcgatgttactagcagcagaagtcagattgtag

DBGET integrated database retrieval system