KEGG   Homo sapiens (human): 94160Help
Entry
94160             CDS       T01001                                 

Gene name
ABCC12, MRP9
Definition
ATP-binding cassette, sub-family C (CFTR/MRP), member 12
Orthology
K05672  
ATP-binding cassette, subfamily C (CFTR/MRP), member 12
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:hsa02010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q12.1
AA seq 1359 aa AA seqDB search
MVGEGPYLISDLDQRGRRRSFAERYDPSLKTMIPVRPCARLAPNPVDDAGLLSFATFSWL
TPVMVKGYRQRLTVDTLPPLSTYDSSDTNAKRFRVLWDEEVARVGPEKASLSHVVWKFQR
TRVLMDIVANILCIIMAAIGPVILIHQILQQTERTSGKVWVGIGLCIALFATEFTKVFFW
ALAWAINYRTAIRLKVALSTLVFENLVSFKTLTHISVGEVLNILSSDSYSLFEAALFCPL
PATIPILMVFCAAYAFFILGPTALIGISVYVIFIPVQMFMAKLNSAFRRSAILVTDKRVQ
TMNEFLTCIRLIKMYAWEKSFTNTIQDIRRRERKLLEKAGFVQSGNSALAPIVSTIAIVL
TLSCHILLRRKLTAPVAFSVIAMFNVMKFSIAILPFSIKAMAEANVSLRRMKKILIDKSP
PSYITQPEDPDTVLLLANATLTWEHEASRKSTPKKLQNQKRHLCKKQRSEAYSERSPPAK
GATGPEEQSDSLKSVLHSISFVVRKGKILGICGNVGSGKSSLLAALLGQMQLQKGVVAVN
GTLAYVSQQAWIFHGNVRENILFGEKYDHQRYQHTVRVCGLQKDLSNLPYGDLTEIGERG
LNLSGGQRQRISLARAVYSDRQLYLLDDPLSAVDAHVGKHVFEECIKKTLRGKTVVLVTH
QLQFLESCDEVILLEDGEICEKGTHKELMEERGRYAKLIHNLRGLQFKDPEHLYNAAMVE
AFKESPAEREEDAGIIVLAPGNEKDEGKESETGSEFVDTKVPEHQLIQTESPQEGTVTWK
TYHTYIKASGGYLLSLFTVFLFLLMIGSAAFSNWWLGLWLDKGSRMTCGPQGNRTMCEVG
AVLADIGQHVYQWVYTASMVFMLVFGVTKGFVFTKTTLMASSSLHDTVFDKILKSPMSFF
DTTPTGRLMNRFSKDMDELDVRLPFHAENFLQQFFMVVFILVILAAVFPAVLLVVASLAV
GFFILLRIFHRGVQELKKVENVSRSPWFTHITSSMQGLGIIHAYGKKESCITYHLLYFNC
ALRWFALRMDVLMNILTFTVALLVTLSFSSISTSSKGLSLSYIIQLSGLLQVCVRTGTET
QAKFTSVELLREYISTCVPECTHPLKVGTCPKDWPSRGEITFRDYQMRYRDNTPLVLDSL
NLNIQSGQTVGIVGRTGSGKSSLGMALFRLVEPASGTIFIDEVDICILSLEDLRTKLTVI
PQDPVLFVGTVRYNLDPFESHTDEMLWQVLERTFMRDTIMKLPEKLQAEVTENGENFSVG
ERQLLCVARALLRNSKIILLDEATASMDSKTDTLVQNTIKDAFKGCTVLTIAHRLNTVLN
CDHVLVMENGKVIEFDKPEVLAEKPDSAFAMLLAAEVRL
NT seq 4080 nt NT seq  +upstreamnt  +downstreamnt
atggtgggtgaaggaccctaccttatctcagatctggaccagcgaggccggcggagatcc
tttgcagaaagatatgaccccagcctgaagaccatgatcccagtgcgaccctgtgcaagg
ttagcacccaacccggtggatgatgccgggctactctccttcgccacattttcctggctc
acgccggtgatggtgaaaggctaccggcaaaggctgaccgtagacaccctgcccccattg
tcgacatatgactcatctgacaccaatgccaaaagatttcgagtcctttgggatgaagag
gtagcaagggtgggtcctgagaaggcctctctgagccacgtggtgtggaaattccagagg
acacgcgtgttgatggacatcgtggccaacatcctgtgcatcatcatggcagccataggg
ccggtgattctcattcaccaaatcctccagcagactgagaggacctctgggaaagtctgg
gttggcattggactgtgcatagccctttttgccaccgagtttaccaaagtcttcttttgg
gcccttgcctgggccatcaactaccgcacggccatccggttgaaggtggcgctctccacc
ttggtttttgaaaacctagtgtccttcaagacattgacccacatctctgttggcgaggtg
ctcaatatactgtcaagtgatagctattctttgtttgaagctgccttgttttgtcctttg
ccagccaccatcccgatcctaatggtcttttgtgcggcgtacgcctttttcattctgggg
cccacagctctcatcgggatatcagtgtatgtcatattcatacccgtccagatgtttatg
gccaagctcaattcagctttccgaaggtcagcaattttggtgacagacaagcgagttcag
acaatgaatgagtttctgacctgcatcaggctgatcaaaatgtatgcctgggagaaatct
tttaccaacactatccaagatataagaaggagggaaagaaaattactggaaaaagctgga
tttgtccaaagtggaaactctgccctggcccccatcgtgtccaccatagccatcgtgctg
acattatcctgccacatcctcctgagacgcaaactcaccgcacccgtggcatttagtgtg
attgccatgtttaatgtaatgaagttttccattgcaatcttgcccttctccatcaaagca
atggctgaagcgaatgtctctctaaggagaatgaagaaaattctcatagataaaagcccc
ccatcttacatcacccaaccagaagacccagatactgtcttgcttttagcaaatgccacc
ttgacatgggagcatgaagccagcaggaaaagtaccccaaagaaattgcagaaccagaaa
aggcatttatgcaagaaacagaggtcagaggcatacagtgagaggagtccaccagccaag
ggagccactggcccagaggagcaaagtgacagcctcaaatcggttctgcacagcataagc
tttgtggtgagaaaggggaagatcttgggaatatgtgggaatgtgggaagtggaaagagc
tccctccttgcagctctcctaggacagatgcagctgcagaaaggggtggtggcagtcaat
ggaactttggcctacgtttcacagcaggcatggatctttcatggaaatgtgagagaaaac
atactctttggagaaaagtatgatcaccaaaggtatcagcacacagtccgcgtctgtggc
ctccagaaggacctgagcaacctcccctatggagacctgactgagattggggagcggggc
ctcaacctctctggggggcagaggcagaggattagcctggcccgcgctgtctactccgac
cgtcagctctacctgctggacgaccccctgtcggccgtggacgcccacgtggggaagcac
gtctttgaggagtgcattaagaagacgctcaggggaaagacagtcgtcctggtgacccac
cagctacagttcttagagtcttgtgatgaagttattttattagaagatggagagatttgt
gaaaagggaacccacaaggagttaatggaggagagagggcgctatgcaaaactgattcac
aacctgcgaggattgcagttcaaggatcctgaacacctttacaatgcagcaatggtggaa
gccttcaaggagagccctgctgagagagaggaagatgctggtataatcgttttggctcca
ggaaatgagaaagatgaaggaaaagaatctgaaacaggctcagaatttgtagacacaaaa
gttcctgagcaccagctcatccagactgaatccccccaggaaggaaccgtgacctggaaa
acatatcacacgtacattaaggcttctggagggtacctcctttctctcttcactgtgttc
ctcttcctcctgatgattggcagcgctgccttcagcaactggtggctgggtctctggttg
gacaagggctcacggatgacctgtgggccccagggcaacaggaccatgtgtgaggtcggc
gcggtgctggcagacatcggtcagcatgtgtaccagtgggtgtacactgcaagcatggtg
ttcatgctggtgtttggcgtcaccaaaggcttcgtcttcaccaagaccacactgatggca
tcctcctctctgcatgacacggtgtttgataagatcttaaagagcccaatgagtttcttt
gacacgactcccactggcaggctaatgaaccgtttttccaaggatatggacgagctggat
gtgaggctgccgtttcacgcagagaactttctgcagcagttttttatggtggtgtttatt
ctcgtgatcttggctgctgtgtttcctgctgtccttttagtcgtggccagccttgctgta
ggcttcttcattctgttacgcattttccacagaggagtccaggagctcaagaaggtggag
aatgtcagccggtcaccctggttcacccacatcacctcctccatgcagggcctgggcatc
attcacgcctatggcaagaaggagagctgcatcacctatcacctcctctactttaactgt
gctctcaggtggtttgcgctgagaatggatgtcctcatgaacatccttaccttcactgtg
gccttgttggtgaccctgagtttctcctccatcagtacttcatccaaaggcctgtcattg
tcatacatcatccagctgagcggactgctccaagtgtgtgtgcgaacgggaacagagacg
caagccaaattcacctccgtggagctgctcagggaatacatttcgacctgtgttcctgaa
tgcactcatcccctcaaagtggggacctgtcccaaggactggcccagccgtggggagatc
accttcagagactatcagatgagatacagagacaacaccccccttgttctcgacagcctg
aacttgaacatacaaagtgggcagacagtcgggattgttggaagaacaggttccggaaag
tcatcgttaggaatggctttgtttcgtctggtggagccagccagtggcacaatctttatt
gatgaggtggatatctgcattctcagcttggaagacctcagaaccaagctgactgtgatc
ccacaggatcctgtcctgtttgtaggtacagtaaggtacaacttggatccctttgagagt
cacaccgatgagatgctctggcaggttctggagagaacattcatgagagacacaataatg
aaactcccagaaaaattacaggcagaagtcacagaaaatggagaaaacttctcagtaggg
gaacgtcagctgctttgtgtggcccgagctcttctccgtaattcaaagatcattctcctt
gatgaagccaccgcctctatggactccaagactgacaccctggttcagaacaccatcaaa
gatgccttcaagggctgcactgtgctgaccatcgcccaccgcctcaacacagttctcaac
tgcgatcacgtcctggttatggaaaatgggaaggtgattgagtttgacaagcctgaagtc
cttgcagagaagccagattctgcatttgcgatgttactagcagcagaagtcagattgtag

DBGET integrated database retrieval system