KEGG   Homo sapiens (human): 9424Help
Entry
9424              CDS       T01001                                 

Gene name
KCNK6, K2p6.1, KCNK8, TOSS, TWIK-2, TWIK2
Definition
(RefSeq) potassium two pore domain channel subfamily K member 6
  KO
K04917  
potassium channel subfamily K member 6
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNK, K2px.x
   9424 (KCNK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.1
AA seq 313 aa AA seqDB search
MRRGALLAGALAAYAAYLVLGALLVARLEGPHEARLRAELETLRAQLLQRSPCVAAPALD
AFVERVLAAGRLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK
AFSIAFALLGVPTTMLLLTASAQRLSLLLTHVPLSWLSMRWGWDPRRAACWHLVALLGVV
VTVCFLVPAVIFAHLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRALYKVLVTV
YLFLGLVAMVLVLQTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQL
SASSHTDYASIPR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcggaggggcgcgcttctggcgggcgccttggccgcgtacgccgcgtacctggtgctg
ggcgcgctgttggtggcgcggctggaggggccgcacgaagccaggctccgagccgagctg
gagacgctgcgggcgcagctgcttcagcgcagcccgtgtgtggctgcccccgccctggac
gccttcgtggagcgagtgctggcggccggacggctggggcgggtcgtgcttgctaacgct
tcggggtccgccaacgcctcggaccccgcctgggacttcgcctctgctctcttcttcgcc
agcacgctgatcaccaccgtgggctatgggtacacaacgccactgactgatgcgggcaag
gccttctccatcgcctttgcgctcctgggcgtgccgaccaccatgctgctgctgaccgcc
tcagcccagcgcctgtcactgctgctgactcacgtgcccctgtcttggctgagcatgcgt
tggggctgggacccccggcgggcggcctgctggcacttggtggccctgttgggggtcgta
gtgaccgtctgctttctggtgccggctgtgatctttgcccacctcgaggaggcctggagc
ttcttggatgccttctacttctgctttatctctctgtccaccatcggcctgggcgactac
gtgcccggggaggcccctggccagccctaccgggccctctacaaggtgctggtcacagtc
tacctcttcctgggcctggtggccatggtgctggtgctgcagaccttccgccacgtgtcc
gacctccacggcctcacggagctcatcctgctgccccctccgtgccctgccagtttcaat
gcggatgaggacgatcgggtggacatcctgggcccccagccggagtcgcaccagcaactc
tctgccagctcccacaccgactacgcttccatccccaggtag

DBGET integrated database retrieval system