KEGG   Homo sapiens (human): 9426Help
Entry
9426              CDS       T01001                                 

Gene name
CDY2A, CDY, CDY2
Definition
(RefSeq) chromodomain Y-linked 2A
  KO
K00653  chromodomain protein Y [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     9426 (CDY2A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    9426 (CDY2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Chromo Mtf2_C Tudor-knot DUF2607
Motif
Other DBs
NCBI-GeneID: 9426
NCBI-ProteinID: NP_004816
OMIM: 400018
HGNC: 1810
Ensembl: ENSG00000182415
Vega: OTTHUMG00000041657
Pharos: Q9Y6F7(Tdark)
UniProt: Q9Y6F7
Structure
PDB: 

Jmol
Position
Yq11.222
AA seq 541 aa AA seqDB search
MASQEFEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDFNRRQTE
KQKKLTWTTTSRIFSNNARRRTSRSTKANYSKNSPKTPVTDKHHRSKNCKLFAASKNVRR
KAASTLSDTKNMEIINSTIETLAPDSPFDHKKTVSGFQKLEKLDPIAADQQDTVVFKVTE
GKLLRDPLSHPGAEQTGIQNKTQMHPLMSQMSGSVTASMATGSATRKGIVVLIDPLAANG
TTDMHTSVPRVKGGQRNITDDSRGQPFIKKMHFTIRLTESAITYRDIVVKKEDGFTQIVL
STRSTEKNALNTEVIKEMVNALNSAAADDSKLVLFSAAGSVFCCGLDFGYFVRHLRNDRN
TASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTT
FGQSPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQI
KELASYNAIVLEECKALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDE
F
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccaggagtttgaggttgaagctattgttgacaaaagacaggataaaaatggg
aatacacagtatttggttcggtggaaaggttatgacaaacaggatgacacttgggaacca
gagcagcacctcatgaactgtgaaaaatgtgtacatgattttaatagacgacagactgaa
aaacagaaaaaactgacatggactacaaccagtagaattttttcaaacaatgccagaaga
agaacttccagatctacaaaagcaaactattctaagaactctcctaaaactccagtgact
gataaacaccacaggtccaaaaactgcaagttatttgctgccagcaagaacgttaggaga
aaggcagcttcaactctctccgacacaaagaatatggagataataaattcaactattgag
acccttgcacctgacagcccctttgaccacaagaaaactgtgagtggctttcagaaactt
gagaaactggaccctattgcagcagatcagcaggacacggtggtcttcaaggtgacagaa
gggaaactcctccgggaccctttgtcacatcctggtgcagaacagactggaatacagaac
aagactcagatgcacccactaatgtcgcagatgtctggctcagttactgcttctatggcc
acaggttcagctacccgaaagggtatagtggtattaatagacccattagcagccaatggg
acaacagacatgcatacctcagttccaagagtgaaaggtgggcaaagaaatattactgat
gacagcagaggccagccttttatcaagaagatgcacttcaccataaggctaacagaaagt
gccatcacatacagagacattgtagtgaagaaagaggatggattcacccagatagtgcta
tcaactagatcgacagaaaaaaatgcactgaatacagaagtaattaaagaaatggttaat
gctctgaatagcgctgctgcagatgacagcaagctcgtgctgttcagtgcagctggaagt
gtcttttgctgcggtcttgattttgggtactttgtgaggcacttaaggaatgacagaaac
acagcaagccttgaaatggtggacaccatcaagaactttgtgaatacttttattcaattt
aaaaagcctattgttgtatcagtcaatggccctgccattggactaggtgcatccatcctg
cctctttgtgatctcgtgtgggctaatgaaaaggcttggttccaaaccccttatacgacc
tttggacagagtccagatggctgttcttctattacattccccaaaatgatgggtaaagca
tctgccaatgaaatgttaattgctgggcgaaagctgacagcacgggaggcatgcgccaaa
ggcctggtctctcaggtatttttgactggaactttcacccaagaggttatgattcaaatt
aaggagcttgcctcatacaatgcaattgtactggaagaatgtaaggccctcgttcgctgt
aatattaagttggagttggaacaggccaatgagagagagtgtgaggtgctgaggaagatc
tggagctcagcccaagggatagaatccatgttaaagtatgttgaaaataaaattgatgag
ttttaa

DBGET integrated database retrieval system