KEGG   Homo sapiens (human): 94274Help
Entry
94274             CDS       T01001                                 

Gene name
PPP1R14A, CPI-17, CPI17, PPP1INL
Definition
protein phosphatase 1, regulatory (inhibitor) subunit 14A
Orthology
K12328  
protein phosphatase 1 regulatory subunit 14A
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    94274 (PPP1R14A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     94274 (PPP1R14A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.1
AA seq 120 aa AA seqDB search
MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRL
EELYRGMGLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLSPLQDRARTAHP
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcagcggctgggcaagcgcgtgctgagcaagctgcagtctccatcgcgggcc
cgcgggccagggggcagtcccggggggctgcagaagcggcacgcgcgcgtcaccgtcaag
tatgaccggcgggagctgcagcggcggctggacgtggagaagtggatcgacgggcgcctg
gaggagctgtaccgcggcatgggactcctgaagtcatgtgggaaacctgtcgaggacttc
atccaggagctgctggcaaagcttcaaggcctccacaggcagcccggcctccgccagcca
agcccctcccacgacggcagcctcagccccctccaggaccgggcccggactgctcacccc
tga

DBGET integrated database retrieval system