KEGG   Homo sapiens (human): 9429Help
Entry
9429              CDS       T01001                                 

Gene name
ABCG2, ABC15, ABCP, BCRP, BCRP1, BMDP, CD338, CDw338, EST157481, GOUT1, MRX, MXR, MXR1, UAQTL1
Definition
ATP-binding cassette, sub-family G (WHITE), member 2
Orthology
K05681  
ATP-binding cassette, subfamily G (WHITE), member 2
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Bile secretion
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:hsa02010]
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q22
AA seq 611 aa AA seqDB search
MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVE
KEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCN
SGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGT
QFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF
SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIING
DSTAVALNREEDFKATEIIEPSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKK
ITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDS
TGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP
MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLL
MTICFVFMMVCWSISQPLHLGCHGFSTSAFHDMDLRLCSIMNFWDKTSAQDSMQQETILV
TMQHVLAKNIW
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccagtaatgtcgaagtttttatcccagtgtcacaaggaaacaccaatggcttc
cccgcgacagcttccaatgacctgaaggcatttactgaaggagctgtgttaagttttcat
aacatctgctatcgagtaaaactgaagagtggctttctaccttgtcgaaaaccagttgag
aaagaaatattatcgaatatcaatgggatcatgaaacctggtctcaacgccatcctggga
cccacaggtggaggcaaatcttcgttattagatgtcttagctgcaaggaaagatccaagt
ggattatctggagatgttctgataaatggagcaccgcgacctgccaatttcaaatgtaat
tcaggttacgtggtacaagatgatgttgtgatgggcactctgacggtgagagaaaactta
cagttctcagcagctcttcggcttgcaacaactatgacgaatcatgaaaaaaacgaacgg
attaacagggtcattcaagagttaggtctggataaagtggcagactccaaggttggaact
cagtttatccgtggtgtgtctggaggagaaagaaaaaggactagtataggaatggagctt
atcactgatccttccatcttgttcttggatgagcctacaactggcttagactcaagcaca
gcaaatgctgtccttttgctcctgaaaaggatgtctaagcagggacgaacaatcatcttc
tccattcatcagcctcgatattccatcttcaagttgtttgatagcctcaccttattggcc
tcaggaagacttatgttccacgggcctgctcaggaggccttgggatactttgaatcagct
ggttatcactgtgaggcctataataaccctgcagacttcttcttggacatcattaatgga
gattccactgctgtggcattaaacagagaagaagactttaaagccacagagatcatagag
ccttccaagcaggataagccactcatagaaaaattagcggagatttatgtcaactcctcc
ttctacaaagagacaaaagctgaattacatcaactttccgggggtgagaagaagaagaag
atcacagtcttcaaggagatcagctacaccacctccttctgtcatcaactcagatgggtt
tccaagcgttcattcaaaaacttgctgggtaatccccaggcctctatagctcagatcatt
gtcacagtcgtactgggactggttataggtgccatttactttgggctaaaaaatgattct
actggaatccagaacagagctggggttctcttcttcctgacgaccaaccagtgtttcagc
agtgtttcagccgtggaactctttgtggtagagaagaagctcttcatacatgaatacatc
agcggatactacagagtgtcatcttatttccttggaaaactgttatctgatttattaccc
atgaggatgttaccaagtattatatttacctgtatagtgtacttcatgttaggattgaag
ccaaaggcagatgccttcttcgttatgatgtttacccttatgatggtggcttattcagcc
agttccatggcactggccatagcagcaggtcagagtgtggtttctgtagcaacacttctc
atgaccatctgttttgtgtttatgatggtctgttggtcaatctcacaaccattgcatctt
ggctgtcatggcttcagtacttcagcattccacgatatggatttacggctttgcagcata
atgaatttttgggacaaaacttctgcccaggactcaatgcaacaggaaacaatccttgta
actatgcaacatgtactggcgaagaatatttggtaa

DBGET integrated database retrieval system