KEGG   Homo sapiens (human): 9436Help
Entry
9436              CDS       T01001                                 

Gene name
NCR2, CD336, LY95, NK-p44, NKP44, dJ149M18.1
Definition
natural cytotoxicity triggering receptor 2
Orthology
K06742  
natural cytotoxicity triggering receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    9436 (NCR2)
Cellular antigens [BR:hsa04090]
 Proteins
  9436 (NCR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.1
AA seq 270 aa AA seqDB search
MAWRALHPLLLLLLLFPGSQAQSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASA
LVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVS
KSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSHPSS
PLPVPLPSRPQNSTLRPGPAAPIALVPVFCGLLVAKSLVLSALLVWWVLRNRHMQHQGRS
LLHPAQPRPQAHRHFPLSHRAPGGTYGGKP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcgagccctacacccactgctactgctgctgctgctgttcccaggctctcag
gcacaatccaaggctcaggtacttcaaagtgtggcagggcagacgctaaccgtgagatgc
cagtacccgcccacgggcagtctctacgagaagaaaggctggtgtaaggaggcttcagca
cttgtgtgcatcaggttagtcaccagctccaagcccaggacgatggcttggacctctcga
ttcacaatctgggacgaccctgatgctggcttcttcactgtcaccatgactgatctgaga
gaggaagactcaggacattactggtgtagaatctaccgcccttctgacaactctgtctct
aagtccgtcagattctatctggtggtatctccagcctctgcctccacacagacctcctgg
actccccgcgacctggtctcttcacagacccagacccagagctgtgtgcctcccactgca
ggagccagacaagcccctgagtctccatctaccatccctgtcccttcacacccgtcctct
ccccttcctgtccctctgccttccaggccacagaactccacgctccgccctggccctgca
gcccccattgccctggtgcctgtgttctgtggactcctcgtagccaagagcctggtgctg
tcagccctgctcgtctggtgggttttaaggaatcggcacatgcagcatcaagggaggtct
ctgctgcacccagctcagcccaggccccaggcccatagacacttcccactgagccacagg
gcaccaggggggacatatggtggaaaaccatga

DBGET integrated database retrieval system