KEGG   Homo sapiens (human): 9437Help
Entry
9437              CDS       T01001                                 

Gene name
NCR1, CD335, LY94, NK-p46, NKP46
Definition
natural cytotoxicity triggering receptor 1
Orthology
K06741  
natural cytotoxicity triggering receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    9437 (NCR1)
Cellular antigens [BR:hsa04090]
 Proteins
  9437 (NCR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.42
AA seq 303 aa AA seqDB search
MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQL
HFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEM
YDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPV
TTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWGTYLLTTETG
LQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNT
QTL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccacactccctgccctgctctgcgtcgggctgtgtctgagtcagaggatcagc
gcccagcagcagactctcccaaaaccgttcatctgggccgagccccatttcatggttcca
aaggaaaagcaagtgaccatctgttgccagggaaattatggggctgttgaataccagctg
cactttgaaggaagcctttttgccgtggacagaccaaaaccccctgagcggattaacaaa
gtccaattctacatcccggacatgaactcccgcatggcagggcaatacagctgcatctat
cgggttggggagctctggtcagagcccagcaacttgctggatctggtggtaacagaaatg
tatgacacacccaccctctcggttcatcctggacccgaagtgatctcgggagagaaggtg
accttctactgccgtctagacactgcaacaagcatgttcttactgctcaaggagggaaga
tccagccacgtacagcgcggatacgggaaggtccaggcggagttccccctgggccctgtg
accacagcccacagagggacataccgatgttttggctcctataacaaccatgcctggtct
ttccccagtgagccagtgaagctcctggtcacaggcgacattgagaacaccagccttgca
cctgaagaccccacctttcctgacacttggggcacctaccttttaaccacagagacggga
ctccagaaagaccatgccctctgggatcacactgcccagaatctccttcggatgggcctg
gcctttctagtcctggtggctctagtgtggttcctggttgaagactggctcagcaggaag
aggactagagagcgagccagcagagcttccacttgggaaggcaggagaaggctgaacaca
cagactctttga

DBGET integrated database retrieval system