KEGG   Homo sapiens (human): 944Help
Entry
944               CDS       T01001                                 

Gene name
TNFSF8, CD153, CD30L, CD30LG
Definition
tumor necrosis factor (ligand) superfamily, member 8
Orthology
K05471  
tumor necrosis factor ligand superfamily member 8
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    944 (TNFSF8)
Cellular antigens [BR:hsa04090]
 Proteins
  944 (TNFSF8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
9q33
AA seq 234 aa AA seqDB search
MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVL
VVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGI
LHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESG
MQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggacccagggctgcagcaagcactcaacggaatggcccctcctggagacacagccatg
catgtgccggcgggctccgtggccagccacctggggaccacgagccgcagctatttctat
ttgaccacagccactctggctctgtgccttgtcttcacggtggccactattatggtgttg
gtcgttcagaggacggactccattcccaactcacctgacaacgtccccctcaaaggagga
aattgctcagaagacctcttatgtatcctgaaaagggctccattcaagaagtcatgggcc
tacctccaagtggcaaagcatctaaacaaaaccaagttgtcttggaacaaagatggcatt
ctccatggagtcagatatcaggatgggaatctggtgatccaattccctggtttgtacttc
atcatttgccaactgcagtttcttgtacaatgcccaaataattctgtcgatctgaagttg
gagcttctcatcaacaagcatatcaaaaaacaggccctggtgacagtgtgtgagtctgga
atgcaaacgaaacacgtataccagaatctctctcaattcttgctggattacctgcaggtc
aacaccaccatatcagtcaatgtggatacattccagtacatagatacaagcacctttcct
cttgagaatgtgttgtccatcttcttatacagtaattcagactga

DBGET integrated database retrieval system