KEGG   Homo sapiens (human): 9441Help
Entry
9441              CDS       T01001                                 

Gene name
MED26, CRSP7, CRSP70
Definition
(RefSeq) mediator complex subunit 26
  KO
K15169  
mediator of RNA polymerase II transcription subunit 26
Organism
hsa  Homo sapiens (human)
Brite
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Other mediators
     9441 (MED26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.11
AA seq 600 aa AA seqDB search
MTAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDV
RKKTKNEELAKRAKKLLRSWQKLIEPAHQHEAALRGLAGATGSANGGAHNCRPEVGAAGP
PRSIHDLKSRNDLQRLPGQRLDRLGSRKRRGDQRDLGHPGPPPKVSKASHDPLVPNSSPL
PTNGISGSPESFASSLDGSGHAGPEGSRLERDENDKHSGKIPVNAVRPHTSSPGLGKPPG
PCLQPKASVLQQLDRVDETPGPPHPKGPPRCSFSPRNSRHEGSFARQQSLYAPKGSVPSP
SPRPQALDATQVPSPLPLAQPSTPPVRRLELLPSAESPVCWLEQPESHQRLAGPGCKAGL
SPAEPLLSRAGFSPDSSKADSDAASSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKPVRL
KERKLTFDPMTRQIKPLTQKEPVRADSPVHMEQQSRTELDKQEAKASLQSPFEQTNWKEL
SRNEIIQSYLSRQSSLLSSSGAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDL
PGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgacagcggctccggcgtctccgcagcagatcagggaccggctgctgcaggccatcgac
ccccagagcaacatccggaacatggtggcggtgctggaagtcatctccagcctggagaaa
taccctattaccaaagaggcacttgaggaaacacgacttgggaagctcatcaacgacgtc
cgcaagaaaaccaagaacgaggagctcgccaagcgggccaagaagctgctgcggagctgg
cagaagctcatcgagccggcacaccagcatgaggcggcgctgcgggggctggcgggggcc
accggctctgccaacgggggcgcacacaactgccggccggaggtgggggcggctggccca
cccaggagcatccatgacctgaagagccgcaatgacctccagaggctgcccgggcagcgg
ctggacaggctgggcagccgcaagcgccggggtgaccagcgtgacctcggccacccaggg
ccgccacccaaggtctccaaagctagccacgaccccctggtccccaactcatcccccctc
cccaccaacgggatcagtgggagtccagagagcttcgccagctccctggatggcagtggg
catgcaggcccagagggcagccgcctggagcgtgacgagaatgacaagcacagtggcaag
atccccgtcaacgccgtgcgaccgcacaccagctccccgggcctgggcaagccccctgga
ccctgcttgcagccaaaggcttcggtgctgcagcagctggacagggtggacgagactccg
gggcctccccatcccaagggaccccctcgctgctctttcagtcctcggaactcacggcat
gagggctcctttgcccggcagcagagcttgtatgcacccaagggctccgtgcccagcccc
tcaccgcggccccaggcactcgatgccacacaggtgccgtcaccgcttccactggcacag
ccgtccacaccccccgtacggcggctcgagctgctgcccagtgcggaaagcccagtgtgc
tggcttgagcagcctgagagccaccagcggctggcggggccgggctgcaaggcagggctg
tccccagccgagcccctcctgtcccgggcaggcttttccccagactcctccaaggcggac
agtgatgctgcctcctcagggggctcggacagtaaaaagaagaagaggtaccgacctcga
gactatacggttaacttggacgggcaggtggctgaggcgggcgtcaagcctgtccggtta
aaagagcggaagctcacctttgaccccatgacgagacagatcaaacctctgacccagaaa
gagccagtgcgggcagacagccctgtgcacatggagcagcagtccaggacagagctggac
aagcaggaggccaaggccagcctccagagccccttcgaacagacgaactggaaggagctg
tcacgcaacgagatcatccagtcctacctgagccggcagagcagcctgctctcatcatcg
ggcgcgcagaccccaggggctcaccacttcatgtctgagtacctgaagcaggaggagagc
acccggcaaggggccaggcagctgcatgtgctggtgcctcaaagcccgcccacggacctc
cctggtctgacccgggaggtcacacaggacgatctcgacagaatccaggccagccagtgg
ccgggggtgaacgggtgtcaggacacacagggtaactggtatgactggacgcagtgcata
tcgctcgatccgcacggcgacgacgggcgcttgaacattctgccttatgtctgcttggac
tga

DBGET integrated database retrieval system