KEGG   Homo sapiens (human): 9446Help
Entry
9446              CDS       T01001                                 

Gene name
GSTO1, GSTO_1-1, GSTTLp28, HEL-S-21, P28, SPG-R
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    9446 (GSTO1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    9446 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    9446 (GSTO1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    9446 (GSTO1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    9446 (GSTO1)
  Drug resistance
   01524 Platinum drug resistance
    9446 (GSTO1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     9446 (GSTO1)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   9446 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P78417(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
10q25.1
AA seq 241 aa AA seqDB search
MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKP
EWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELF
SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPW
FERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggagtcagccaggagcttggggaagggaagcgcgcccccggggccggtcccg
gagggctcgatccgcatctacagcatgaggttctgcccgtttgctgagaggacgcgtcta
gtcctgaaggccaagggaatcaggcatgaagtcatcaatatcaacctgaaaaataagcct
gagtggttctttaagaaaaatccctttggtctggtgccagttctggaaaacagtcagggt
cagctgatctacgagtctgccatcacctgtgagtacctggatgaagcatacccagggaag
aagctgttgccggatgacccctatgagaaagcttgccagaagatgatcttagagttgttt
tctaaggtgccatccttggtaggaagctttattagaagccaaaataaagaagactatgct
ggcctaaaagaagaatttcgtaaagaatttaccaagctagaggaggttctgactaataag
aagacgaccttctttggtggcaattctatctctatgattgattacctcatctggccctgg
tttgaacggctggaagcaatgaagttaaatgagtgtgtagaccacactccaaaactgaaa
ctgtggatggcagccatgaaggaagatcccacagtctcagccctgcttactagtgagaaa
gactggcaaggtttcctagagctctacttacagaacagccctgaggcctgtgactatggg
ctctga

DBGET integrated database retrieval system