KEGG   Homo sapiens (human): 9447Help
Entry
9447              CDS       T01001                                 

Gene name
AIM2, PYHIN4
Definition
absent in melanoma 2
Orthology
K12966  
absent in melanoma 2
Organism
hsa  Homo sapiens (human)
Pathway
Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04623 Cytosolic DNA-sensing pathway
    9447 (AIM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q22
AA seq 343 aa AA seqDB search
MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATLMIQNAGAVS
AVMKTIRIFQKLNYMLLAKRLQEEKEKVDKQYKSVTKPKPLSQAEMSPAASAAIRNDVAK
QRAAPKVSPHVKPEQKQMVAQQESIREGFQKRCLPVMVLKAKKPFTFETQEGKQEMFHAT
VATEKEFFFVKVFNTLLKDKFIPKRIIIIARYYRHSGFLEVNSASRVLDAESDQKVNVPL
NIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNED
TMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVIKAKKKT
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggagagtaaatacaaggagatactcttgctaacaggcctggataacatcactgatgag
gaactggataggtttaagttctttctttcagacgagtttaatattgccacaggcaaacta
catactgcaaacagaatacaagtagctaccttgatgattcaaaatgctggggcggtgtct
gcagtgatgaagaccattcgtatttttcagaagttgaattatatgcttttggcaaaacgt
cttcaggaggagaaggagaaagttgataagcaatacaaatcggtaacaaaaccaaagcca
ctaagtcaagctgaaatgagtcctgctgcatctgcagccatcagaaatgatgtcgcaaag
caacgtgctgcaccaaaagtctctcctcatgttaagcctgaacagaaacagatggtggcc
cagcaggaatctatcagagaagggtttcagaagcgctgtttgccagttatggtactgaaa
gcaaagaagcccttcacgtttgagacccaagaaggcaagcaggagatgtttcatgctaca
gtggctacagaaaaggaattcttctttgtaaaagtttttaatacactgctgaaagataaa
ttcattccaaagagaataattataatagcaagatattatcggcacagtggtttcttagag
gtaaatagcgcctcacgtgtgttagatgctgaatctgaccaaaaggttaatgtcccgctg
aacattatcagaaaagctggtgaaaccccgaagatcaacacgcttcaaactcagcccctt
ggaacaattgtgaatggtttgtttgtagtccagaaggtaacagaaaagaagaaaaacata
ttatttgacctaagtgacaacactgggaaaatggaagtactgggggttagaaacgaggac
acaatgaaatgtaaggaaggagataaggttcgacttacattcttcacactgtcaaaaaat
ggagaaaaactacagctgacatctggagttcatagcaccataaaggttattaaggccaaa
aaaaaaacatag

DBGET integrated database retrieval system