KEGG   Homo sapiens (human): 9447Help
Entry
9447              CDS       T01001                                 

Gene name
AIM2, PYHIN4
Definition
(RefSeq) absent in melanoma 2
  KO
K12966  absent in melanoma 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    9447 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    9447 (AIM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HIN PYRIN DUF2950 tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 9447
NCBI-ProteinID: NP_004824
OMIM: 604578
HGNC: 357
Ensembl: ENSG00000163568
Vega: OTTHUMG00000037183
Pharos: O14862(Tbio)
UniProt: O14862
Structure
PDB: 

Jmol
Position
1q23.1-q23.2
AA seq 343 aa AA seqDB search
MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATLMIQNAGAVS
AVMKTIRIFQKLNYMLLAKRLQEEKEKVDKQYKSVTKPKPLSQAEMSPAASAAIRNDVAK
QRAAPKVSPHVKPEQKQMVAQQESIREGFQKRCLPVMVLKAKKPFTFETQEGKQEMFHAT
VATEKEFFFVKVFNTLLKDKFIPKRIIIIARYYRHSGFLEVNSASRVLDAESDQKVNVPL
NIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNED
TMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVIKAKKKT
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggagagtaaatacaaggagatactcttgctaacaggcctggataacatcactgatgag
gaactggataggtttaagttctttctttcagacgagtttaatattgccacaggcaaacta
catactgcaaacagaatacaagtagctaccttgatgattcaaaatgctggggcggtgtct
gcagtgatgaagaccattcgtatttttcagaagttgaattatatgcttttggcaaaacgt
cttcaggaggagaaggagaaagttgataagcaatacaaatcggtaacaaaaccaaagcca
ctaagtcaagctgaaatgagtcctgctgcatctgcagccatcagaaatgatgtcgcaaag
caacgtgctgcaccaaaagtctctcctcatgttaagcctgaacagaaacagatggtggcc
cagcaggaatctatcagagaagggtttcagaagcgctgtttgccagttatggtactgaaa
gcaaagaagcccttcacgtttgagacccaagaaggcaagcaggagatgtttcatgctaca
gtggctacagaaaaggaattcttctttgtaaaagtttttaatacactgctgaaagataaa
ttcattccaaagagaataattataatagcaagatattatcggcacagtggtttcttagag
gtaaatagcgcctcacgtgtgttagatgctgaatctgaccaaaaggttaatgtcccgctg
aacattatcagaaaagctggtgaaaccccgaagatcaacacgcttcaaactcagcccctt
ggaacaattgtgaatggtttgtttgtagtccagaaggtaacagaaaagaagaaaaacata
ttatttgacctaagtgacaacactgggaaaatggaagtactgggggttagaaacgaggac
acaatgaaatgtaaggaaggagataaggttcgacttacattcttcacactgtcaaaaaat
ggagaaaaactacagctgacatctggagttcatagcaccataaaggttattaaggccaaa
aaaaaaacatag

DBGET integrated database retrieval system