KEGG   Homo sapiens (human): 9451Help
Entry
9451              CDS       T01001                                 

Gene name
EIF2AK3, PEK, PERK, WRS
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 3 (EC:2.7.11.1)
  KO
K08860  
eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Hepatitis C
Measles
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Disease
H00512  
Permanent neonatal diabetes mellitus (PNDM)
H00766  
Wolcott-Rallison syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9451 (EIF2AK3)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    9451 (EIF2AK3)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    9451 (EIF2AK3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    9451 (EIF2AK3)
  Infectious diseases
   05162 Measles
    9451 (EIF2AK3)
   05164 Influenza A
    9451 (EIF2AK3)
   05160 Hepatitis C
    9451 (EIF2AK3)
   05168 Herpes simplex infection
    9451 (EIF2AK3)
   05169 Epstein-Barr virus infection
    9451 (EIF2AK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9451 (EIF2AK3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  PEK family [OT]
   9451 (EIF2AK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p12
AA seq 1116 aa AA seqDB search
MERAISPGLLVRALLLLLLLLGLAARTVAAGRARGLPAPTAEAAFGLGAAAAPTSATRVP
AAGAVAAAEVTVEDAEALPAAAGEQEPRGPEPDDETELRPRGRSLVIISTLDGRIAALDP
ENHGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGALFQWDQDRESMETVPFTVES
LLESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRQWDSDEMEQEEDILLLQR
TQKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTFKPNENTEESKIISDVEE
QEAAIMDIVIKVSVADWKVMAFSKKGGHLEWEYQFCTPIASAWLLKDGKVIPISLFDDTS
YTSNDDVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPSSPKALESVTNE
NAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGY
YLPYYKRERNKRSTQITVRFLDNPHYNKNIRKKDPVLLLHWWKEIVATILFCIIATTFIV
RRLFHPHPHRQRKESETQCQTENKYDSVSGEANDSSWNDIKNSGYISRYLTDFEPIQCLG
RGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLE
APPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFATKEHIEIIAPSPQRSR
SFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDSCLTDCDVEDGTMDGND
EGHSFELCPSEASPYVRSRERTSSSIVFEDSGCDNASSKEEPKTNRLHIGNHCANKLTAF
KPTSSKSSSEATLSISPPRPTTLSLDLTKNTTEKLQPSSPKVYLYIQMQLCRKENLKDWM
NGRCTIEERERSVCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVT
AMDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLYP
FSTQMERVRTLTDVRNLKFPPLFTQKYPCEYVMVQDMLSPSPMERPEAINIIENAVFEDL
DFPGKTVLRQRSRSLSSSGTKHSRQSNNSHSPLPSN
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgccatcagcccggggctgctggtacgggcgctgctgctgctgctgctgctg
ctggggctcgcggcaaggacggtggccgcggggcgcgcccgtggcctcccagcgccgacg
gcggaggcggcgttcggcctcggggcggccgctgctcccacctcagcgacgcgagtaccg
gcggcgggcgccgtggctgcggccgaggtgactgtggaggacgctgaggcgctgccggca
gccgcgggagagcaggagcctcggggtccggaaccagacgatgagacagagttgcgaccg
cgcggcaggtcattagtaattatcagcactttagatgggagaattgctgccttggatcct
gaaaatcatggtaaaaagcagtgggatttggatgtgggatccggttccttggtgtcatcc
agccttagcaaaccagaggtatttgggaataagatgatcattccttccctggatggagcc
ctcttccagtgggaccaagaccgtgaaagcatggaaacagttcctttcacagttgaatca
cttcttgaatcttcttataaatttggagatgatgttgttttggttggaggaaaatctctg
actacatatggactcagtgcatatagtggaaaggtgaggtatatctgttcagctctgggt
tgtcgccaatgggatagtgacgaaatggaacaagaggaagacatcctgcttctacagcgt
acccaaaaaactgttagagctgtcggacctcgcagtggcaatgagaagtggaatttcagt
gttggccactttgaacttcggtatattccagacatggaaacgagagccggatttattgaa
agcacctttaagcccaatgagaacacagaagagtctaaaattatttcagatgtggaagaa
caggaagctgccataatggacatagtgataaaggtttcggttgctgactggaaagttatg
gcattcagtaagaagggaggacatctggaatgggagtaccagttttgtactccaattgca
tctgcctggttacttaaggatgggaaagtcattcccatcagtctttttgatgatacaagt
tatacatctaatgatgatgttttagaagatgaagaagacattgtagaagctgccagagga
gccacagaaaacagtgtttacttgggaatgtatagaggccagctgtatctgcagtcatca
gtcagaatttcagaaaagtttccttcaagtcccaaggctttggaatctgtcactaatgaa
aacgcaattattcctttaccaacaatcaaatggaaacccttaattcattctccttccaga
actcctgtcttggtaggatctgatgaatttgacaaatgtctcagtaatgataagttttct
catgaagaatatagtaatggtgcactttcaatcttgcagtatccatatgataatggttat
tatctaccatactacaagagggagaggaacaaacgaagcacacagattacagtcagattc
ctcgacaacccacattacaacaagaatatccgcaaaaaggatcctgttcttcttttacac
tggtggaaagaaatagttgcaacgattttgttttgtatcatagcaacaacgtttattgtg
cgcaggcttttccatcctcatcctcacaggcaaaggaaggagtctgaaactcagtgtcaa
actgaaaataaatatgattctgtaagtggtgaagccaatgacagtagctggaatgacata
aaaaactctggatatatatcacgatatctaactgattttgagccaattcaatgcctggga
cgtggtggctttggagttgtttttgaagctaaaaacaaagtagatgactgcaattatgct
atcaagaggatccgtctccccaatagggaattggctcgggaaaaggtaatgcgagaagtt
aaagccttagccaagcttgaacacccgggcattgttagatatttcaatgcctggctcgaa
gcaccaccagagaagtggcaagaaaagatggatgaaatttggctgaaagatgaaagcaca
gactggccactcagctctcctagcccaatggatgcaccatcagttaaaatacgcagaatg
gatcctttcgctacaaaagaacatattgaaatcatagctccttcaccacaaagaagcagg
tctttttcagtagggatttcctgtgaccagacaagttcatctgagagccagttctcacca
ctggaattctcaggaatggaccatgaggacatcagtgagtcagtggatgcagcatacaac
ctccaggacagttgccttacagactgtgatgtggaagatgggactatggatggcaatgat
gaggggcactcctttgaactttgtccttctgaagcttctccttatgtaaggtcaagggag
agaacctcctcttcaatagtatttgaagattctggctgtgataatgcttccagtaaagaa
gagccgaaaactaatcgattgcatattggcaaccattgtgctaataaactaactgctttc
aagcccaccagtagcaaatcttcttctgaagctacattgtctatttctcctccaagacca
accactttaagtttagatctcactaaaaacaccacagaaaaactccagcccagttcacca
aaggtgtatctttacattcaaatgcagctgtgcagaaaagaaaacctcaaagactggatg
aatggacgatgtaccatagaggagagagagaggagcgtgtgtctgcacatcttcctgcag
atcgcagaggcagtggagtttcttcacagtaaaggactgatgcacagggacctcaagcca
tccaacatattctttacaatggatgatgtggtcaaggttggagactttgggttagtgact
gcaatggaccaggatgaggaagagcagacggttctgaccccaatgccagcttatgccaga
cacacaggacaagtagggaccaaactgtatatgagcccagagcagattcatggaaacagc
tattctcataaagtggacatcttttctttaggcctgattctatttgaattgctgtatcca
ttcagcactcagatggagagagtcaggaccttaactgatgtaagaaatctcaaatttcca
ccattatttactcagaaatatccttgtgagtacgtgatggttcaagacatgctctctcca
tcccccatggaacgacctgaagctataaacatcattgaaaatgctgtatttgaggacttg
gactttccaggaaaaacagtgctcagacagaggtctcgctccttgagttcatcgggaaca
aaacattcaagacagtccaacaactcccatagccctttgccaagcaattag

DBGET integrated database retrieval system