KEGG   Homo sapiens (human): 9454Help
Entry
9454              CDS       T01001                                 

Gene name
HOMER3, HOMER-3, VESL3
Definition
homer homolog 3 (Drosophila)
Orthology
K15010  
homer
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    9454 (HOMER3)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    9454 (HOMER3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.11
AA seq 358 aa AA seqDB search
MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAII
NSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKS
QDGGELTSPALGLASHQVPPSPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLSEGSV
GEVQWEAEFFALQDSNNKLAGALREANAAAAQWRQQLEAQRAEAERLRQRVAELEAQAAS
EVTPTGEKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGGPREALEAAEREETQQKVQTR
NAELEHQLRAMERSLEEARAERERARAEVGRAAQLLDVSLFELSELREGLARLAEAAP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtccacagccagggagcagccaatcttcagcacacgggcgcacgtgttccaaattgac
ccagccaccaagcgaaactggatcccagcgggcaagcacgcactcactgtctcctatttc
tacgatgccacccgcaatgtgtaccgcatcatcagcatcggaggcgccaaggccatcatc
aacagcactgtcactcccaacatgaccttcaccaaaacttcccagaagttcgggcagtgg
gccgacagtcgcgccaacacagtctacggcctgggctttgcctctgaacagcatctgaca
cagtttgccgagaagttccaggaagtgaaggaagcagccaggctggccagggagaaatct
caggatggcggggagctcaccagtccagccctggggctcgcctcccaccaggtgcccccg
agccctctcgtcagtgccaacggccccggcgaggaaaaactgttccgcagccagagcgct
gatgcccccggccccacagagcgcgagcggctaaagaagatgttgtctgagggctccgtg
ggcgaggtacagtgggaggccgagtttttcgcactgcaggacagcaacaacaagctggca
ggcgccctgcgagaggccaacgccgccgcagcccagtggaggcagcagctggaggctcag
cgtgcagaggccgagcggctgcggcagcgggtggctgagctggaggctcaggcagcttca
gaggtgacccccaccggtgagaaggaggggctgggccagggccagtcgctggaacagctg
gaagctctggtgcaaaccaaggaccaggagattcagaccctgaagagtcagactgggggg
ccccgcgaggccctggaggctgccgagcgtgaggagactcagcagaaggtgcagacccgc
aatgcggagttggagcaccagctgcgggcgatggagcgcagcctggaggaggcacgggca
gagcgggagcgggcgcgggctgaggtgggccgggcagcgcagctgctggacgtcagcctg
tttgagctgagtgagctgcgtgagggcctggcccgcctggctgaggctgcgccctga

DBGET integrated database retrieval system