KEGG   Homo sapiens (human): 9455Help
Entry
9455              CDS       T01001                                 

Gene name
HOMER2, ACPD, CPD, HOMER-2, VESL-2
Definition
homer homolog 2 (Drosophila)
Orthology
K15010  
homer
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Glutamatergic synapse
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q24.3
AA seq 343 aa AA seqDB search
MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINST
ITPNMTFTKTSQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEK
IETSSNHSQASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANVKKWEIELQTLR
ESNARLTTALQESAASVEQWKRQFSICRDENDRLRNKIDELEEQCSEINREKEKNTQLKR
RIEELEAELREKETELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTD
IEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKLGTDN
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggagaacagcccatcttcaccacccgagcgcatgtcttccagattgaccccaacacc
aagaagaactggatgcctgcgagcaagcaggcggtcaccgtttcctacttctatgatgtc
acaaggaacagctatcggatcatcagtgtggacggagccaaggtgatcataaacagcaca
atcacaccgaatatgaccttcaccaaaacgtcacagaagtttgggcagtgggccgacagc
agagccaacacagtgtttggtttggggttttcctctgagcagcagctgacaaagtttgca
gagaaattccaggaggtgaaagaagctgccaagatagccaaagacaagacgcaggagaaa
atcgagacctcaagtaatcattcccaagcatccagtgtcaacgggacggacgatgaaaag
gcctctcacgccggtccagccaacacacacctgaagtctgagaatgacaagctgaagatt
gccttgacgcagagcgcagccaacgtgaagaagtgggagatcgagctgcagacccttcgg
gagagcaatgcacggctgaccacagcactgcaggagtcggcagccagtgtggagcagtgg
aagaggcagttctccatctgccgtgatgagaatgaccggctccgcaacaagattgatgag
ctggaagaacaatgcagtgagatcaacagagagaaggagaagaacacgcagctgaagagg
aggatcgaggagctggaggcagagctccgagaaaaggagacagagctgaaagatctccga
aaacaaagtgaaatcatacctcagctcatgtcagagtgcgaatatgtctctgagaagcta
gaggcggcagagagagacaatcaaaacctggaagacaaagtgcgttccttaaagacagac
attgaggagagcaaataccgacagcgccacctgaaggtggagttgaagagcttcctggag
gtgctggacgggaagattgacgacctgcatgacttccgccgagggctctccaagctgggc
accgataactag

DBGET integrated database retrieval system