KEGG   Homo sapiens (human): 9456Help
Entry
9456              CDS       T01001                                 

Gene name
HOMER1, HOMER, HOMER1A, HOMER1B, HOMER1C, SYN47, Ves-1
Definition
(RefSeq) homer scaffolding protein 1
  KO
K15010  
homer
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    9456 (HOMER1)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    9456 (HOMER1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q14.2
AA seq 354 aa AA seqDB search
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINST
ITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEK
MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAIS
KHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQAN
AVHTHKTELNQTIQELEETLKLKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKD
LEGQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKLLECS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggggaacaacctatcttcagcactcgagctcatgtcttccaaattgacccaaacaca
aagaagaactgggtacccaccagcaagcatgcagttactgtgtcttatttctatgacagc
acaagaaatgtgtataggataatcagtttagatggctcaaaggcaataataaatagtacc
atcaccccaaacatgacatttactaaaacatctcagaagtttggccagtgggctgatagc
cgggcaaacaccgtttatggattgggattctcctctgagcatcatctttcgaaatttgca
gaaaagtttcaggaatttaaagaagctgctcgactagcaaaggaaaaatcacaagagaag
atggaacttaccagtacaccttcacaggaatccgcaggcggggatcttcagtctccttta
acaccggaaagtatcaacgggacagatgatgaaagaacacctgatgtgacacagaactca
gagccaagggctgaaccaactcagaatgcattgccattttcacatagttcagcaatcagc
aaacattgggaggctgaactggctaccctcaaaggaaataatgccaaactcactgcagcc
ctgctggagtccactgccaatgtgaaacaatggaaacagcaacttgctgcctatcaagag
gaagcagaacgtctgcacaagcgggtgactgaacttgaatgtgttagtagccaagcaaat
gcagtacatactcataagacagaattaaatcagacaatacaagaactggaagagacactg
aaactgaaggaagaggaaatagaaaggttaaaacaagaaattgataatgccagagaacta
caagaacagagggattctttgactcagaaactacaggaagtagaaattcggaacaaagac
ctggagggacaactgtctgacttagagcaacgtctggagaaaagtcagaatgaacaagaa
gcttttcgcaataacctgaagacactcttagaaattctggatggaaagatatttgaacta
acagaattacgagataacttggccaagctactagaatgcagctaa

DBGET integrated database retrieval system