KEGG   Homo sapiens (human): 947Help
Entry
947               CDS       T01001                                 

Gene name
CD34
Definition
CD34 molecule
Orthology
K06474  
CD34 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Hematopoietic cell lineage
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q32
AA seq 385 aa AA seqDB search
MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQE
TTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTV
FTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGI
REVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRP
QCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGAL
LAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQ
ENGTGQATSRNGHSARQHVVADTEL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgctggtccgcaggggcgcgcgcgcagggcccaggatgccgcggggctggaccgcgctt
tgcttgctgagtttgctgccttctgggttcatgagtcttgacaacaacggtactgctacc
ccagagttacctacccagggaacattttcaaatgtttctacaaatgtatcctaccaagaa
actacaacacctagtacccttggaagtaccagcctgcaccctgtgtctcaacatggcaat
gaggccacaacaaacatcacagaaacgacagtcaaattcacatctacctctgtgataacc
tcagtttatggaaacacaaactcttctgtccagtcacagacctctgtaatcagcacagtg
ttcaccaccccagccaacgtttcaactccagagacaaccttgaagcctagcctgtcacct
ggaaatgtttcagacctttcaaccactagcactagccttgcaacatctcccactaaaccc
tatacatcatcttctcctatcctaagtgacatcaaggcagaaatcaaatgttcaggcatc
agagaagtgaaattgactcagggcatctgcctggagcaaaataagacctccagctgtgcg
gagtttaagaaggacaggggagagggcctggcccgagtgctgtgtggggaggagcaggct
gatgctgatgctggggcccaggtatgctccctgctccttgcccagtctgaggtgaggcct
cagtgtctactgctggtcttggccaacagaacagaaatttccagcaaactccaacttatg
aaaaagcaccaatctgacctgaaaaagctggggatcctagatttcactgagcaagatgtt
gcaagccaccagagctattcccaaaagaccctgattgcactggtcacctcgggagccctg
ctggctgtcttgggcatcactggctatttcctgatgaatcgccgcagctggagccccaca
ggagaaaggctgggcgaagacccttattacacggaaaacggtggaggccagggctatagc
tcaggacctgggacctcccctgaggctcagggaaaggccagtgtgaaccgaggggctcag
gaaaacgggaccggccaggccacctccagaaacggccattcagcaagacaacacgtggtg
gctgataccgaattgtga

DBGET integrated database retrieval system