KEGG   Homo sapiens (human): 9470Help
Entry
9470              CDS       T01001                                 

Gene name
EIF4E2, 4E-LP, 4EHP, EIF4EL3, IF4e
Definition
(RefSeq) eukaryotic translation initiation factor 4E family member 2
  KO
K03259  
translation initiation factor 4E
Organism
hsa  Homo sapiens (human)
Pathway
EGFR tyrosine kinase inhibitor resistance
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Longevity regulating pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    9470 (EIF4E2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    9470 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    9470 (EIF4E2)
   04150 mTOR signaling pathway
    9470 (EIF4E2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    9470 (EIF4E2)
  Aging
   04211 Longevity regulating pathway - mammal
    9470 (EIF4E2)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    9470 (EIF4E2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     9470 (EIF4E2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     9470 (EIF4E2)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    9470 (EIF4E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
O60573(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2q37.1
AA seq 245 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKP
RLNVP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaagttcgacgctttgaaagatgatgacagtggggaccatgatcagaatgaa
gaaaacagcacacagaaagatggtgagaaggaaaaaacggaacgagacaagaatcagagc
agtagcaagagaaaggctgttgtccctggaccggcagagcatcccctgcagtacaactac
actttttggtactccaggagaacccccggccgtcccacgagctcacagagctatgaacag
aatatcaaacagattggcacctttgcctctgtggagcagttctggaggttttatagccac
atggtacgtcctggggacctgacaggccacagtgacttccatctcttcaaagaaggaatt
aaacccatgtgggaggatgatgcaaataaaaatggtggcaagtggattattcggctgcgg
aagggcttggcctcccgttgctgggagaatctcattttggccatgctgggggaacagttc
atggttggggaggagatctgtggggctgtggtgtctgtccgctttcaggaagacattatt
tcaatatggaataagactgccagtgaccaagcaaccacagcccgaatccgggacacactt
cggcgagtgcttaacctacctcccaacaccattatggaatacaaaactcacaccgacagc
atcaaaatgccaggcaggctgggcccccaaaggctcctttttcaaaacctctggaagccg
cggttgaatgtgccatga

DBGET integrated database retrieval system