KEGG   Homo sapiens (human): 9472Help
Entry
9472              CDS       T01001                                 

Gene name
AKAP6, ADAP100, ADAP6, AKAP100, PRKA6, mAKAP
Definition
(RefSeq) A-kinase anchoring protein 6
  KO
K16523  
A-kinase anchor protein 6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
14q12
AA seq 2319 aa AA seqDB search
MLTMSVTLSPLRSQDLDPMATDASPMAINMTPTVEQGEGEEAMKDMDSDQQYEKPPPLHT
GADWKIVLHLPEIETWLRMTSERVRDLTYSVQQDSDSKHVDVHLVQLKDICEDISDHVEQ
IHALLETEFSLKLLSYSVNVIVDIHAVQLLWHQLRVSVLVLRERILQGLQDANGNYTRQT
DILQAFSEETKEGRLDSLTEVDDSGQLTIKCSQNYLSLDCGITAFELSDYSPSEDLLSGL
GDMTSSQVKTKPFDSWSYSEMEKEFPELIRSVGLLTVAADSISTNGSEAVTEEVSQVSLS
VDDKGGCEEDNASAVEEQPGLTLGVSSSSGEALTNAAQPSSETVQQESSSSSHHDAKNQQ
PVPCENATPKRTIRDCFNYNEDSPTQPTLPKRGLFLKEETFKNDLKGNGGKRQMVDLKPE
MSRSTPSLVDPPDRSKLCLVLQSSYPNSPSAASQSYECLHKVGNGNLENTVKFHIKEISS
SLGRLNDCYKEKSRLKKPHKTSEEVPPCRTPKRGTGSGKQAKNTKSSAVPNGELSYTSKA
IEGPQTNSASTSSLEPCNQRSWNAKLQLQSETSSSPAFTQSSESSVGSDNIMSPVPLLSK
HKSKKGQASSPSHVTRNGEVVEAWYGSDEYLALPSHLKQTEVLALKLENLTKLLPQKPRG
ETIQNIDDWELSEMNSDSEIYPTYHVKKKHTRLGRVSPSSSSDIASSLGESIESGPLSDI
LSDEESSMPLAGMKKYADEKSERASSSEKNESHSATKSALIQKLMQDIQHQDNYEAIWEK
IEGFVNKLDEFIQWLNEAMETTENWTPPKAEMDDLKLYLETHLSFKLNVDSHCALKEAVE
EEGHQLLELIASHKAGLKDMLRMIASQWKELQRQIKRQHSWILRALDTIKAEILATDVSV
EDEEGTGSPKAEVQLCYLEAQRDAVEQMSLKLYSEQYTSSSKRKEEFADMSKVHSVGSNG
LLDFDSEYQELWDWLIDMESLVMDSHDLMMSEEQQQHLYKRYSVEMSIRHLKKTELLSKV
EALKKGGVLLPNDLLEKVDSINEKWELLGKTLGEKIQDTMAGHSGSSPRDLLSPESGSLV
RQLEVRIKELKGWLRDTELFIFNSCLRQEKEGTMNTEKQLQYFKSLCREIKQRRRGVASI
LRLCQHLLDDRETCNLNADHQPMQLIIVNLERRWEAIVMQAVQWQTRLQKKMGKESETLN
VIDPGLMDLNGMSEDALEWDEMDISNKLISLNEESNDLDQELQPVIPSLKLGETSNEDPG
YDEEADNHGGSQYASNITAPSSPHIYQVYSLHNVELYEDNHMPFLKNNPKVTGMTQPNVL
TKSLSKDSSFSSTKSLPDLLGGSNLVKPCACHGGDMSQNSGSESGIVSEGDTETTTNSEM
CLLNAVDGSPSNLETEHLDPQMGDAVNVLKQKFTDEGESIKLPNSSQSSISPVGCVNGKV
GDLNSITKHTPDCLGEELQGKHDVFTFYDYSYLQGSKLKLPMIMKQSQSEKAHVEDPLLR
GFYFDKKSCKSKHQTTELQPDVPPHERILASASHEMDRISYKSGNIEKTFTGMQNAKQLS
LLSHSSSIESLSPGGDLFGLGIFKNGSDSLQRSTSLESWLTSYKSNEDLFSCHSSGDISV
SSGSVGELSKRTLDLLNRLENIQSPSEQKIKRSVSDITLQSSSQKMSFTGQMSLDIASSI
NEDSAASLTELSSSDELSLCSEDIVLHKNKIPESNASFRKRLTRSVADESDVNVSMIVNV
SCTSACTDDEDDSDLLSSSTLTLTEEELCIKDEDDDSSIATDDEIYEDCTLMSGLDYIKN
ELQTWIRPKLSLTRDKKRCNVSDEMKGSKDISSSEMTNPSDTLNIETLLNGSVKRVSENN
GNGKNSSHTHELGTKRENKKTIFKVNKDPYVADMENGNIEGIPERQKGKPNVTSKVSENL
GSHGKEISESEHCKCKALMDSLDDSNTAGKEFVSQDVRHLPKKCPNHHHFENQSTASTPT
EKSFSELALETRFNNRQDSDALKSSDDAPSMAGKSAGCCLALEQNGTEENASISNISCCN
CEPDVFHQKDAEDCSVHNFVKEIIDMASTALKSKSQPENEVAAPTSLTQIKEKVLEHSHR
PIQLRKGDFYSYLSLSSHDSDCGEVTNYIEEKSSTPLPLDTTDSGLDDKEDIECFFEACV
EGDSDGEEPCFSSAPPNESAVPSEAAMPLQATACSSEFSDSSLSADDADTVALSSPSSQE
RAEVGKEVNGLPQTSSGCAENLEFTPSKLDSEKESSGKPGESGMPEEHNAASAKSKVQDL
SLKANQPTDKAALHPSPKTLTCEENLLNLHEKRHRNMHR
NT seq 6960 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccatgagcgtgacactttcccccctgaggtcacaggacctggatcccatggct
actgatgcttcacccatggccatcaacatgacacccactgtggagcagggtgagggagaa
gaggcaatgaaggacatggactctgaccagcagtatgaaaagccacccccactacacaca
ggggctgactggaagattgtcctccacttacctgaaattgagacctggctccggatgacc
tcagagagggtccgagacctaacctattcagtccagcaggattcggacagcaagcatgtg
gatgtacatctagttcaactaaaggacatttgtgaagatatttctgatcatgttgagcaa
atccatgccctccttgaaacagagttctccctaaagctgctgtcttactctgtcaacgtg
atagtggacatccacgcagtgcagctcctctggcaccagcttcgagtctcagtgctggtt
ctgcgggagcgcattctgcaaggtctgcaggacgccaatggcaactacactaggcagacg
gacattctgcaagctttctctgaagagacaaaagagggccggcttgattctctaacagaa
gtggatgactcaggacaattaaccatcaaatgttctcaaaattacttgtctctggattgt
ggcattactgcattcgaactgtctgactacagtccaagtgaggatttgctcagtgggcta
ggtgacatgacctctagccaagtcaaaaccaaaccctttgactcttggagctacagtgag
atggaaaaggagtttcctgagcttatccgaagtgttggtttacttacggtagctgctgac
tctatctctaccaatggcagtgaagcagttactgaggaggtatctcaagtatctctctca
gtagacgacaaaggtggatgtgaggaagacaatgcttctgcagtcgaagagcaaccaggc
ttaacactgggggtgtcatcatcttcaggagaagctctgacaaatgctgctcaaccctcc
tctgagactgtgcagcaagaatccagttcctcctcccatcatgatgcaaagaatcagcag
cctgttccttgtgaaaatgcaacccccaaacgaaccatcagagattgctttaattataac
gaggactctcccacgcagcctacattgccaaaaagaggactttttcttaaagaggaaact
tttaagaatgatctgaaaggcaatggtggaaagaggcaaatggttgatctaaagcctgag
atgagcagaagcaccccttcgctagtagatcctcctgacagatccaaactttgcctggta
ttgcagtcttcttaccccaacagcccttctgctgccagccagtcttatgagtgtttacac
aaggtggggaatgggaaccttgaaaacacagtcaaatttcacattaaagaaatttcttcc
agcctgggaaggcttaacgactgctataaagagaaatctcgacttaaaaagccacacaag
acctcagaagaggtgcctccatgccgaacacctaaacgggggactggttcaggcaaacaa
gctaaaaatacaaagagctcagcagtgccaaatggagagctttcttatacttccaaggcc
atagaggggccacaaacaaattctgcttccacatcctcacttgagccttgtaatcagaga
agttggaatgccaaattgcaattgcagtcagaaacatccagttcaccagcttttactcag
agcagtgaatcctctgttggctcagacaacatcatgtctccggtgccacttctttcaaaa
cacaaaagcaaaaaaggtcaagcctcctctccaagtcacgtcactaggaatggtgaggtt
gtggaggcctggtatggctctgatgaatacctagcactgccctctcaccttaagcagaca
gaagtattggctttgaagttggaaaacctaacaaagcttctgcctcagaaacccagagga
gaaaccatccagaatattgatgactgggaactgtctgaaatgaattcagattctgaaatc
tatccaacctatcatgtcaaaaagaagcatacaaggctaggcagggtgtctccaagctca
tctagtgacatagcctcttcactaggggagagcattgaatctgggcccctgagtgacatt
ctttctgatgaggagtccagtatgcctctcgctggcatgaaaaagtatgctgatgagaag
tcagaaagagcttcatcctctgagaaaaatgagagccattctgccactaaatcagcttta
attcagaaactgatgcaagatattcagcaccaagacaactatgaagccatatgggaaaaa
atagaggggtttgtaaacaaactggatgaattcattcaatggttaaatgaagccatggaa
actacagagaattggactccccctaaagcagagatggatgaccttaaactgtatctggag
acacacttgagttttaagttgaatgtagacagtcattgtgctctcaaggaagctgtggag
gaggaaggacaccaacttcttgagcttattgcatctcacaaagcaggactgaaggacatg
ctgcggatgattgcaagtcaatggaaggagctgcagaggcaaatcaaacggcagcacagc
tggattctcagggctctggataccatcaaagccgagatactggctactgatgtgtctgtg
gaggatgaggaagggactggaagccccaaggctgaggttcaactatgctacctggaagca
caaagagatgctgttgagcagatgtccctcaagctgtacagcgagcagtataccagcagc
agcaagcgaaaggaagagtttgctgatatgtcaaaagttcattcagtgggaagcaatggg
cttctggactttgattcagaatatcaggagctctgggattggctgattgacatggagtcc
cttgtgatggacagccacgacctgatgatgtcagaggagcagcagcagcatctttacaag
cgatacagtgtggaaatgtccatcagacacctgaaaaagacggagctgcttagtaaggtt
gaagctttgaagaaaggtggcgttttactaccaaatgatctccttgaaaaagtggattca
attaatgaaaaatgggaactgcttgggaaaaccctaggagagaagatccaggacacaatg
gcagggcacagtgggtcgagtccacgtgacctgctctctcctgaaagtggaagcctggta
aggcagctggaggtcaggatcaaagaactgaaaggatggctaagagatacagagcttttc
atcttcaattcctgtctgagacaagaaaaggaaggaacaatgaatactgagaaacaactg
caatactttaagtccctctgtcgtgaaatcaagcaacgacgtcgaggagttgcctccatt
ctgcgactatgccagcatcttttggatgaccgggagacttgcaatctgaatgcagaccac
cagcccatgcagctgatcattgtaaatcttgaaagaaggtgggaagccattgtcatgcaa
gccgtccagtggcaaacacgtctacaaaagaagatgggaaaggaatctgagactttgaat
gtgattgatcctggcttgatggacctaaatgggatgagtgaggatgccctggaatgggat
gaaatggacataagtaacaagttaattagtttgaatgaggaatcaaatgaccttgatcaa
gaactccaacctgttatcccttccttgaagcttggagagacaagtaatgaggaccctggt
tatgacgaggaggctgataaccatgggggatctcagtatgcctcaaatattactgccccc
tctagtccacacatttaccaggtgtacagcctccacaatgttgaactctatgaggacaac
cacatgccatttctgaaaaacaatccaaaggtcactggcatgacacagcctaatgtttta
actaagagtctcagtaaagactcttcattttcatctaccaaatctttgccagatcttcta
ggtggttccaatttggtaaagccctgcgcatgtcatggaggagacatgagccagaattca
ggcagtgagagtggaattgtcagtgaaggagacacagaaaccactaccaactctgaaatg
tgcttgctcaatgcagtggatgggtccccaagtaaccttgaaactgaacatctggaccca
caaatgggagatgcagttaacgtgttaaagcaaaaatttacagatgagggggaaagcatt
aagcttccaaatagctctcagtcgtccatttcaccagtgggttgtgtaaatggaaaagtt
ggagatttaaacagtattaccaaacatacccctgactgtttgggagaagaattacaagga
aaacatgatgtgtttacattttatgattactcatacctccaaggctcaaaactcaaatta
ccaatgataatgaaacagtcacaaagcgaaaaagcgcatgtggaggatcccctgcttcgt
ggtttttattttgataaaaaatcatgcaaatctaaacatcagactacagagttacaacca
gatgtacctccccatgaaaggattttggcaagtgcatctcatgaaatggatcgcatttca
tataaaagtggcaatatagaaaagacattcactggcatgcagaatgccaaacagctctcc
cttttatctcatagttcatctattgagtccctttctccagggggtgatttatttggattg
ggcatctttaaaaatggcagtgacagcctccagcgaagcacttctttagaaagttggttg
acttcctataaaagcaatgaagatctctttagctgtcacagctctggggatataagcgtg
agcagtggctcagttggtgaactaagtaaaagaacattagatctcctgaatcgtttggag
aatatccagagcccctcagagcaaaagataaaacgaagtgtttctgatatcactcttcaa
agcagttcccaaaagatgtcctttactggccagatgtcattggacatagcatcttctatc
aatgaagactcagcggcatctctaacagaacttagcagcagtgacgagctctctctttgc
tcagaggatattgtgttacacaagaacaagatcccggaatcgaatgcatcgttcaggaag
cgtctgactcgttcagtggctgatgaaagcgatgtcaatgtcagcatgattgttaatgtc
tcttgcacctctgcttgcactgatgatgaagatgacagcgacctgctctccagctctacc
cttaccttgactgaagaagagctgtgcatcaaagatgaggatgacgactccagtattgca
acagatgatgaaatttatgaagactgcaccttgatgtcagggctagactacataaagaat
gaattacagacctggattaggccaaaattgtctttgacaagagataagaaaaggtgcaat
gtcagtgatgagatgaagggcagtaaagatataagtagcagtgagatgaccaatccctct
gatactctgaatattgagacccttctaaatggctctgtaaaacgtgtctctgaaaataat
ggaaatggtaagaattcatctcatacccatgagttagggacaaagcgtgaaaataagaaa
actattttcaaagttaataaagatccatatgtggctgacatggaaaatggcaatattgaa
ggtattccagaaaggcaaaagggaaaaccgaatgtgacttcaaaggtatcagaaaatctt
ggttcacatgggaaagagatttcagagagtgagcattgtaagtgtaaagcacttatggat
agtttagatgattcaaatactgctggcaaggaatttgtttcccaagatgttagacatctt
ccaaagaaatgtccaaatcaccaccattttgaaaatcaaagcactgcctctactcccact
gagaagtctttctcagaactggctttagaaaccaggtttaacaacagacaagactctgat
gcactgaaatcatctgatgatgcaccgagtatggctggaaaatctgctggttgttgccta
gcacttgaacaaaacggaacagaggaaaatgcttctatcagcaacatttcctgttgcaac
tgtgagccagatgttttccatcaaaaagatgccgaagattgttcagtacacaactttgtt
aaggaaatcattgacatggcttcgacagccctaaaaagtaaatctcaacctgaaaacgag
gtggctgctcctacttcattaactcaaatcaaggagaaagtgttggagcattctcaccgg
cccatccagctgagaaaaggggacttttattcgtacttatctctctcatctcatgacagt
gattgtggggaggtcaccaattacatagaagagaaaagcagcactccattgccactagac
accactgactcgggcttagatgacaaggaagatattgaatgcttttttgaggcctgtgtt
gagggtgactctgatggagaggagccttgtttctctagtgctcctccaaatgaatctgca
gttcccagcgaagctgcaatgccactacaagcaacagcatgttcttctgagttcagtgat
agttctctttcagctgatgatgcagatacagtggctctttcaagtccttcctctcaggaa
agagctgaggttggaaaggaagtgaatggtttgccccaaacttccagtggctgtgcagaa
aacttagagtttactccttcaaagcttgacagtgaaaaggaaagttccggaaaaccaggt
gaatctggaatgccagaagaacataatgctgcttcagccaaatctaaagttcaagacctc
tccttgaaggcaaatcagccaacagacaaggccgcattgcatcccagccccaaaacttta
acctgtgaagaaaatcttctaaaccttcatgaaaaacgacatagaaatatgcataggtag

DBGET integrated database retrieval system