KEGG   Homo sapiens (human): 9474Help
Entry
9474              CDS       T01001                                 

Gene name
ATG5, APG5, APG5-LIKE, APG5L, ASP, hAPG5
Definition
autophagy related 5
Orthology
K08339  
autophagy-related protein 5
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of autophagy
RIG-I-like receptor signaling pathway
Shigellosis
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:hsa04140]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q21
AA seq 275 aa AA seqDB search
MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVM
RQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDA
IEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEEN
GFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMI
HGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgacaaagatgtgcttcgagatgtgtggtttggacgaattccaacttgtttc
acgctatatcaggatgagataactgaaagggaagcagaaccatactatttgcttttgcca
agagtaagttatttgacgttggtaactgacaaagtgaaaaagcactttcagaaggttatg
agacaagaagacattagtgagatatggtttgaatatgaaggcacaccactgaaatggcat
tatccaattggtttgctatttgatcttcttgcatcaagttcagctcttccttggaacatc
acagtacattttaagagttttccagaaaaagaccttctgcactgtccatctaaggatgca
attgaagctcattttatgtcatgtatgaaagaagctgatgctttaaaacataaaagtcaa
gtaatcaatgaaatgcagaaaaaagatcacaagcaactctggatgggattgcaaaatgac
agatttgaccagttttgggccatcaatcggaaactcatggaatatcctgcagaagaaaat
ggatttcgttatatcccctttagaatatatcagacaacgactgaaagacctttcattcag
aagctgtttcgtcctgtggctgcagatggacagttgcacacactaggagatctcctcaaa
gaagtttgtccttctgctattgatcctgaagatggggaaaaaaagaatcaagtgatgatt
catggaattgagccaatgttggaaacacctctgcagtggctgagtgaacatctgagctac
ccggataattttcttcatattagtatcatcccacagccaacagattga

DBGET integrated database retrieval system