KEGG   Homo sapiens (human): 9475Help
Entry
9475              CDS       T01001                                 

Gene name
ROCK2, ROCK-II
Definition
(RefSeq) Rho associated coiled-coil containing protein kinase 2
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa04921  Oxytocin signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
Drug target
Fasudil (DG00293): D01840 D03115 D07941
Netarsudil (DG02692): D11030 D11031
Ripasudil hydrochloride hydrate: D10463
Verosudil (DG01867): D10737 D10738
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    9475 (ROCK2)
   04071 Sphingolipid signaling pathway
    9475 (ROCK2)
   04024 cAMP signaling pathway
    9475 (ROCK2)
   04022 cGMP - PKG signaling pathway
    9475 (ROCK2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    9475 (ROCK2)
   04530 Tight junction
    9475 (ROCK2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    9475 (ROCK2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    9475 (ROCK2)
   04670 Leukocyte transendothelial migration
    9475 (ROCK2)
   04062 Chemokine signaling pathway
    9475 (ROCK2)
  Endocrine system
   04921 Oxytocin signaling pathway
    9475 (ROCK2)
  Circulatory system
   04270 Vascular smooth muscle contraction
    9475 (ROCK2)
  Development
   04360 Axon guidance
    9475 (ROCK2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    9475 (ROCK2)
   05205 Proteoglycans in cancer
    9475 (ROCK2)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    9475 (ROCK2)
   05132 Salmonella infection
    9475 (ROCK2)
   05131 Shigellosis
    9475 (ROCK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9475 (ROCK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   9475 (ROCK2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    9475 (ROCK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 APH
Motif
Other DBs
NCBI-GeneID: 9475
NCBI-ProteinID: NP_004841
OMIM: 604002
HGNC: 10252
Ensembl: ENSG00000134318
Vega: OTTHUMG00000149916
Pharos: O75116(Tclin)
UniProt: O75116 Q14DU5
Structure
PDB: 

Jmol
Position
2p25.1
AA seq 1388 aa AA seqDB search
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNL
MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
ETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLV
GTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWH
WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL
LLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKT
AKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQL
EDLKKRNQNSQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNR
DLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRICGLEEDLKNGKI
LLAKVELEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNK
IYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLK
QKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMN
LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQK
KQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE
LTEKDATIASLEETNRTLTSDVANLANEKEELNNKLKDVQEQLSRLKDEEISAAAIKAQF
EKQLLTERTLKTQAVNKLAEIMNRKEPVKRGNDTDVRRKEKENRKLHMELKSEREKLTQQ
MIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPG
DAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVL
DIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKG
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
ISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSR
QLAPNKPS
NT seq 4167 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcccccgccgacggggaaaatgcccggcgcccccgagaccgcgccgggggac
ggggcaggcgcgagccgccagaggaagctggaggcgctgatccgagaccctcgctccccc
atcaacgtggagagcttgctggatggcttaaattccttggtccttgatttagattttcct
gctttgaggaaaaacaagaacatagataatttcttaaatagatatgagaaaattgtgaaa
aaaatcagaggtctacagatgaaggcagaagactatgatgttgtaaaagttattggaaga
ggtgcttttggtgaagtgcagttggttcgtcacaaggcatcgcagaaggtttatgctatg
aagcttcttagtaagtttgaaatgataaaaagatcagattctgcctttttttgggaagaa
agagatattatggcctttgccaatagcccctgggtggttcagcttttttatgcctttcaa
gatgataggtatctgtacatggtaatggagtacatgcctggtggagaccttgtaaacctt
atgagtaattatgatgtgcctgaaaaatgggccaaattttacactgctgaagttgttctt
gctctggatgcaatacactccatgggtttaatacacagagatgtgaagcctgacaacatg
ctcttggataaacatggacatctaaaattagcagattttggcacgtgtatgaagatggat
gaaacaggcatggtacattgtgatacagcagttggaacaccggattatatatcacctgag
gttctgaaatcacaagggggtgatggtttctatgggcgagaatgtgattggtggtctgta
ggtgttttcctttatgagatgctagtgggggatactccattttatgcggattcacttgta
ggaacatatagcaaaattatggatcataagaattcactgtgtttccctgaagatgcagaa
atttccaaacatgcaaagaatctcatctgtgctttcttaacagatagggaggtacgactt
gggagaaatggggtggaagaaatcagacagcatcctttctttaagaatgatcagtggcat
tgggataacataagagaaacggcagctcctgtagtacctgaactcagcagtgacatagac
agcagcaatttcgatgacattgaagatgacaaaggagatgtagaaaccttcccaattcct
aaagcttttgttggaaatcagctgcctttcatcggatttacctactatagagaaaattta
ttattaagtgactctccatcttgtagagaaactgattccatacaatcaaggaaaaatgaa
gaaagtcaagagattcagaaaaaactgtatacattagaagaacatcttagcaatgagatg
caagccaaagaggaactggaacagaagtgcaaatctgttaatactcgcctagaaaaaaca
gcaaaggagctagaagaggagattaccttacggaaaagtgtggaatcagcattaagacag
ttagaaagagaaaaggcgcttcttcagcacaaaaatgcagaatatcagaggaaagctgat
catgaagcagacaaaaaacgaaatttggaaaatgatgttaacagcttaaaagatcaactt
gaagatttgaaaaaaagaaatcaaaactctcaaatatccactgagaaagtgaatcaactc
cagagacaactggatgaaaccaatgctttactgcgaacagagtctgatactgcagcccgg
ttaaggaaaacccaggcagaaagttcaaaacagattcagcagctggaatctaacaataga
gatctacaagataaaaactgcctgctggagactgccaagttaaaacttgaaaaggaattt
atcaatcttcagtcagctctagaatctgaaaggagggatcgaacccatggatcagagata
attaatgatttacaaggtagaatatgtggcctagaagaagatttaaagaacggcaaaatc
ttactagcgaaagtagaactggagaagagacaacttcaggagagatttactgatttggaa
aaggaaaaaagcaacatggaaatagatatgacataccaactaaaagttatacagcagagc
ctagaacaagaagaagctgaacataaggccacaaaggcacgactagcagataaaaataag
atctatgagtccatcgaagaagccaaatcagaagccatgaaagaaatggagaagaagctc
ttggaggaaagaactttaaaacagaaagtggagaacctattgctagaagctgagaaaaga
tgttctctattagactgtgacctcaaacagtcacagcagaaaataaatgagctccttaaa
cagaaagatgtgctaaatgaggatgttagaaacctgacattaaaaatagagcaagaaact
cagaagcgctgccttacacaaaatgacctgaagatgcaaacacaacaggttaacacacta
aaaatgtcagaaaagcagttaaagcaagaaaataaccatctcatggaaatgaaaatgaac
ttggaaaaacaaaatgctgaacttcgaaaagaacgtcaggatgcagatgggcaaatgaaa
gagctccaggatcagctcgaagcagaacagtatttctcaaccctttataaaacacaagtt
agggagcttaaagaagaatgtgaagaaaagaccaaacttggtaaagaattgcagcagaag
aaacaggaattacaggatgaacgggactctttggctgcccaactggagatcaccttgacc
aaagcagattctgagcaactggctcgttcaattgctgaagaacaatattctgatttggaa
aaagagaagatcatgaaagagctggagatcaaagagatgatggctagacacaaacaggaa
cttacggaaaaagatgctacaattgcttctcttgaggaaactaataggacactaactagt
gatgttgccaatcttgcaaatgagaaagaagaattaaataacaaattgaaagatgttcaa
gagcaactgtcaagattgaaagatgaagaaataagcgcagcagctattaaagcacagttt
gagaagcagctattaacagaaagaacactcaaaactcaagctgtgaataagttggctgag
atcatgaatcgaaaagaacctgtcaagcgtggtaatgacacagatgtgcggagaaaagag
aaggagaatagaaagctacatatggagcttaaatctgaacgtgagaaattgacccagcag
atgatcaagtatcagaaagaactgaatgaaatgcaggcacaaatagctgaagagagccag
attcgaattgaactgcagatgacattggacagtaaagacagtgacattgagcagctgcgg
tcacaactccaagccttgcatattggtctggatagttccagtataggcagtggaccaggg
gatgctgaggcagatgatgggtttccagaatcaagattagaaggatggctttcattgcct
gtacgaaacaacactaagaaatttggatgggttaaaaagtatgtgattgtaagcagtaag
aagattcttttctatgacagtgaacaagataaagaacaatccaatccttacatggtttta
gatatagacaagttatttcatgtccgaccagttacacagacagatgtgtatagagcagat
gctaaagaaattccaaggatattccagattctgtatgccaatgaaggagaaagtaagaag
gaacaagaatttccagtggagccagttggagaaaaatctaattatatttgccacaaggga
catgagtttattcctactctttatcatttcccaaccaactgtgaggcttgtatgaagccc
ctgtggcacatgtttaagcctcctcctgctttggagtgccgccgttgccatattaagtgt
cataaagatcatatggacaaaaaggaggagattatagcaccttgcaaagtatattatgat
atttcaacggcaaagaatctgttattactagcaaattctacagaagagcagcagaagtgg
gttagtcggttggtgaaaaagatacctaaaaagcccccagctccagacccttttgcccga
tcatctcctagaacttcaatgaagatacagcaaaaccagtctattagacggccaagtcga
cagcttgccccaaacaaacctagctaa

DBGET integrated database retrieval system