KEGG   Homo sapiens (human): 9479Help
Entry
9479              CDS       T01001                                 

Gene name
MAPK8IP1, IB1, JIP-1, JIP1, PRKM8IP
Definition
mitogen-activated protein kinase 8 interacting protein 1
Orthology
K04434  
mitogen-activated protein kinase 8 interacting protein 1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p11.2
AA seq 711 aa AA seqDB search
MAERESGGLGGGAASPPAASPFLGLHIASPPNFRLTHDISLEEFEDEDLSEITDECGISL
QCKDTLSLRPPRAGLLSAGGGGAGSRLQAEMLQMDLIDATGDTPGAEDDEEDDDEERAAR
RPGAGPPKAESGQEPASRGQGQSQGQSQGPGSGDTYRPKRPTTLNLFPQVPRSQDTLNNN
SLGKKHSWQDRVSRSSSPLKTGEQTPPHEHICLSDELPPQSGPAPTTDRGTSTDSPCRRS
TATQMAPPGGPPAAPPGGRGHSHRDRIHYQADVRLEATEEIYLTPVQRPPDAAEPTSAFL
PPTESRMSVSSDPDPAAYPSTAGRPHPSISEEEEGFDCLSSPERAEPPGGGWRGSLGEPP
PPPRASLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASVS
SPYESAIGEEYEEAPRPQPPACLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLF
SCIINGEEQEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFP
AYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLT
VHFNPPSSCVLEISVRGVKIGVKADDSQEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFI
TKHPADHRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcgagaaagcggcggcctgggagggggggccgcgtccccgcccgccgcctcc
ccgttcctggggctgcacatcgcttcgcctcccaatttcaggctcacccatgacatcagc
ctggaggagtttgaggatgaagacctctcggagatcactgatgagtgtggcatcagctta
cagtgcaaagacaccctgtccttacggcccccgcgcgccgggctgctctctgcgggcggc
ggcggcgcggggagccggttgcaggccgagatgctgcagatggacctgatcgacgcgacg
ggggacactcccggggccgaggacgacgaggaggacgacgacgaggagcgcgcggcccgg
cggccgggagcggggccgcccaaggccgagtccggccaggagccggcgtcccgcggccag
ggccagagccaaggccagagccagggcccgggcagcggggacacgtaccggcccaagcgg
cccaccacgctcaacctctttccgcaggtgccgcggtctcaggacacactgaataataat
tctctgggcaaaaagcacagttggcaggatcgggtgtctcgatcatcctcacccctgaag
acaggggagcagacaccaccgcatgaacacatctgcctgagcgatgagctgcccccccag
agcggccccgcccccaccacagatcgaggcacctccaccgacagcccttgccgccgcagc
acagccacccagatggcacctccgggtggtccccctgctgccccgcctgggggtcggggc
cactcgcatcgagaccgaatccactaccaggccgatgtgcgactagaggccactgaggag
atctacctgaccccagtgcagaggcccccagacgctgcagagcccacctccgccttcctg
ccgcccactgagagccggatgtcagtcagctccgatccagaccctgccgcctacccctcc
acggcagggcggccgcacccctccatcagtgaagaggaagagggcttcgactgcctgtcg
tccccagagcgggctgagcccccaggcggagggtggcgggggagcctgggggagccgccg
ccacctccacgggcctctctgagctcggacaccagcgccctgtcctatgactctgtcaag
tacacgctggtggtagatgagcatgcacagctggagctggtgagcctgcggccgtgcttc
ggagactacagtgacgagagtgactctgccaccgtctatgacaactgtgcctccgtctcc
tcgccctatgagtcggccatcggagaggaatatgaggaggccccgcggccccagccccct
gcctgcctctccgaggactccacgcctgatgaacccgacgtccatttctccaagaaattc
ctgaacgtcttcatgagtggccgctcccgctcctccagtgctgagtccttcgggctgttc
tcctgcatcatcaacggggaggagcaggagcagacccaccgggccatattcaggtttgtg
cctcgacacgaagacgaacttgagctggaagtggatgaccctctgctagtggagctccag
gctgaagactactggtacgaggcctacaacatgcgcactggtgcccggggtgtctttcct
gcctattacgccatcgaggtcaccaaggagcccgagcacatggcagccctggccaaaaac
agtgactgggtggaccagttccgggtgaagttcctgggctcagtccaggttccctatcac
aagggcaatgacgtcctctgtgctgctatgcaaaagattgccaccacccgccggctcacc
gtgcactttaacccgccctccagctgtgtcctggagatcagcgtgcggggtgtgaagata
ggcgtcaaggccgatgactcccaggaggccaaggggaataaatgtagccactttttccag
ttaaaaaacatctctttctgcggatatcatccaaagaacaacaagtactttgggttcatc
accaagcaccccgccgaccaccggtttgcctgccacgtctttgtgtctgaagactccacc
aaagccctggcagagtccgtggggagagcattccagcagttctacaagcagtttgtggag
tacacctgccccacagaagatatctacctggagtag

DBGET integrated database retrieval system