KEGG   Homo sapiens (human): 948Help
Entry
948               CDS       T01001                                 

Gene name
CD36, BDPLT10, CHDS7, FAT, GP3B, GP4, GPIV, PASIV, SCARB3
Definition
CD36 molecule (thrombospondin receptor)
Orthology
K06259  
CD36 antigen
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Phagosome
AMPK signaling pathway
ECM-receptor interaction
Hematopoietic cell lineage
Adipocytokine signaling pathway
Fat digestion and absorption
Malaria
Disease
H01108  
CD36 deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    948 (CD36)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    948 (CD36)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    948 (CD36)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    948 (CD36)
  Endocrine system
   04920 Adipocytokine signaling pathway
    948 (CD36)
   03320 PPAR signaling pathway
    948 (CD36)
  Digestive system
   04975 Fat digestion and absorption
    948 (CD36)
 Human Diseases
  Infectious diseases
   05144 Malaria
    948 (CD36)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   948 (CD36)
Cellular antigens [BR:hsa04090]
 Proteins
  948 (CD36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q11.2
AA seq 472 aa AA seqDB search
MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTE
VYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGA
IFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLW
GYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWE
SHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAF
ASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGL
NPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG
TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgaccggaactgtgggctcatcgctggggctgtcattggtgctgtcctggct
gtgtttggaggtattctaatgccagttggagacctgcttatccagaagacaattaaaaag
caagttgtcctcgaagaaggtacaattgcttttaaaaattgggttaaaacaggcacagaa
gtttacagacagttttggatctttgatgtgcaaaatccacaggaagtgatgatgaacagc
agcaacattcaagttaagcaaagaggtccttatacgtacagagttcgttttctagccaag
gaaaatgtaacccaggacgctgaggacaacacagtctctttcctgcagcccaatggtgcc
atcttcgaaccttcactatcagttggaacagaggctgacaacttcacagttctcaatctg
gctgtggcagctgcatcccatatctatcaaaatcaatttgttcaaatgatcctcaattca
cttattaacaagtcaaaatcttctatgttccaagtcagaactttgagagaactgttatgg
ggctatagggatccatttttgagtttggttccgtaccctgttactaccacagttggtctg
ttttatccttacaacaatactgcagatggagtttataaagttttcaatggaaaagataac
ataagtaaagttgccataatcgacacatataaaggtaaaaggaatctgtcctattgggaa
agtcactgcgacatgattaatggtacagatgcagcctcatttccaccttttgttgagaaa
agccaggtattgcagttcttttcttctgatatttgcaggtcaatctatgctgtatttgaa
tccgacgttaatctgaaaggaatccctgtgtatagatttgttcttccatccaaggccttt
gcctctccagttgaaaacccagacaactattgtttctgcacagaaaaaattatctcaaaa
aattgtacatcatatggtgtgctagacatcagcaaatgcaaagaagggagacctgtgtac
atttcacttcctcattttctgtatgcaagtcctgatgtttcagaacctattgatggatta
aacccaaatgaagaagaacataggacatacttggatattgaacctataactggattcact
ttacaatttgcaaaacggctgcaggtcaacctattggtcaagccatcagaaaaaattcaa
gtattaaagaatctgaagaggaactatattgtgcctattctttggcttaatgagactggg
accattggtgatgagaaggcaaacatgttcagaagtcaagtaactggaaaaataaacctc
cttggcctgatagaaatgatcttactcagtgttggtgtggtgatgtttgttgcttttatg
atttcatattgtgcatgcagatcgaaaacaataaaataa

DBGET integrated database retrieval system