KEGG   Homo sapiens (human): 9486Help
Entry
9486              CDS       T01001                                 

Gene name
CHST10, HNK-1ST, HNK1ST
Definition
(RefSeq) carbohydrate sulfotransferase 10
  KO
K09674  carbohydrate 3-sulfotransferase 10 [EC:2.8.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00515  Mannose type O-glycan biosynthesis
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    9486 (CHST10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     9486 (CHST10)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   9486 (CHST10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfotransfer_2 DUF1075
Motif
Other DBs
NCBI-GeneID: 9486
NCBI-ProteinID: NP_004845
OMIM: 606376
HGNC: 19650
Ensembl: ENSG00000115526
Vega: OTTHUMG00000130669
Pharos: O43529(Tbio)
UniProt: O43529
Position
2q11.2
AA seq 356 aa AA seqDB search
MHHQWLLLAACFWVIFMFMVASKFITLTFKDPDVYSAKQEFLFLTTMPEVRKLPEEKHIP
EELKPTGKELPDSQLVQPLVYMERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCDKHK
ILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSDAEIQKRLK
TYFKFFIVRDPFERLISAFKDKFVHNPRFEPWYRHEIAPGIIRKYRRNRTETRGIQFEDF
VRYLGDPNHRWLDLQFGDHIIHWVTYVELCAPCEIMYSVIGHHETLEDDAPYILKEAGID
HLVSYPTIPPGITVYNRTKVEHYFLGISKRDIRRLYARFEGDFKLFGYQKPDFLLN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaccagtggcttctgctggccgcatgcttttgggtgattttcatgttcatggtg
gctagcaagttcatcacgttgacctttaaagacccagatgtgtacagtgccaaacaggag
tttctgttcctgacaaccatgccggaagtgaggaagttgccagaagagaagcacattcct
gaggaactgaagccaactgggaaggagcttccagacagccagctcgttcagcccctggtc
tacatggagcgcctggaactcatcagaaacgtctgcagggatgatgccctgaagaatctc
tcgcacactcctgtctccaagtttgtcctggaccgaatatttgtctgtgacaagcacaag
attcttttctgccagactcccaaagtgggcaacacccagtggaagaaagtgctgattgtt
ctaaatggagcattttcttccattgaggagatccccgaaaacgtggtgcacgaccacgag
aagaacggccttcctcggctctcttccttcagtgatgcagaaattcagaagcgattgaaa
acatacttcaagttttttattgtaagagatcccttcgaaagacttatttctgcatttaag
gataaatttgttcacaatccccggtttgagccttggtacaggcatgagattgctcctggc
atcatcagaaaatacaggaggaaccggacagagacccgggggatccagtttgaagatttc
gtgcgctacctcggcgatccgaaccacagatggctagaccttcagtttggggaccacatc
attcactgggtgacgtatgtagagctctgtgctccctgtgagataatgtacagtgtgatt
ggacaccacgagaccctggaggacgatgccccatacatcttaaaagaggctggcattgac
cacctggtgtcatacccgactatccctccgggcattaccgtgtataacagaaccaaggtg
gagcactatttcctgggcatcagcaaacgagacatccgacgcctgtatgcccgtttcgaa
ggggactttaagctctttgggtaccagaaaccagactttttgctaaactaa

DBGET integrated database retrieval system