KEGG   Homo sapiens (human): 949Help
Entry
949               CDS       T01001                                 

Gene name
SCARB1, CD36L1, CLA-1, CLA1, HDLQTL6, SR-BI, SRB1
Definition
scavenger receptor class B, member 1
Orthology
K13885  
scavenger receptor class B, member 1
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Ovarian steroidogenesis
Fat digestion and absorption
Bile secretion
Vitamin digestion and absorption
Hepatitis C
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:hsa04913]
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
Organismal Systems; Digestive system; Fat digestion and absorption [PATH:hsa04975]
Organismal Systems; Digestive system; Vitamin digestion and absorption [PATH:hsa04977]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.31
AA seq 506 aa AA seqDB search
MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIP
IPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQ
FQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIM
WGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGL
SKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGVFEGIPTYR
FVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAVTG
LHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG
AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQGPEDTVSQPGLAA
GPDRPPSPYTPLLPDSPSGQPPSPTA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgggctgctccgccaaagcgcgctgggctgccggggcgctgggcgtcgcggggctactg
tgcgctgtgctgggcgctgtcatgatcgtgatggtgccgtcgctcatcaagcagcaggtc
cttaagaacgtgcgcatcgaccccagtagcctgtccttcaacatgtggaaggagatccct
atccccttctatctctccgtctacttctttgacgtcatgaaccccagcgagatcctgaag
ggcgagaagccgcaggtgcgggagcgcgggccctacgtgtacagggagttcaggcacaaa
agcaacatcaccttcaacaacaacgacaccgtgtccttcctcgagtaccgcaccttccag
ttccagccctccaagtcccacggctcggagagcgactacatcgtcatgcccaacatcctg
gtcttgggtgcggcggtgatgatggagaataagcccatgaccctgaagctcatcatgacc
ttggcattcaccaccctcggcgaacgtgccttcatgaaccgcactgtgggtgagatcatg
tggggctacaaggacccccttgtgaatctcatcaacaagtactttccaggcatgttcccc
ttcaaggacaagttcggattatttgctgagctcaacaactccgactctgggctcttcacg
gtgttcacgggggtccagaacatcagcaggatccacctcgtggacaagtggaacgggctg
agcaaggttgacttctggcattccgatcagtgcaacatgatcaatggaacttctgggcaa
atgtggccgcccttcatgactcctgagtcctcgctggagttctacagcccggaggcctgc
cgatccatgaagctaatgtacaaggagtcaggggtgtttgaaggcatccccacctatcgc
ttcgtggctcccaaaaccctgtttgccaacgggtccatctacccacccaacgaaggcttc
tgcccgtgcctggagtctggaattcagaacgtcagcacctgcaggttcagtgcccccttg
tttctctcccatcctcacttcctcaacgctgacccggttctggcagaagcggtgactggc
ctgcaccctaaccaggaggcacactccttgttcctggacatccacccggtcacgggaatc
cccatgaactgctctgtgaaactgcagctgagcctctacatgaaatctgtcgcaggcatt
ggacaaactgggaagattgagcctgtggtcctgccgctgctctggtttgcagagagcggg
gccatggagggggagactcttcacacattctacactcagctggtgttgatgcccaaggtg
atgcactatgcccagtacgtcctcctggcgctgggctgcgtcctgctgctggtccctgtc
atctgccaaatccggagccaaggtcctgaggacaccgtgagccagccaggcctggccgct
gggcctgaccggccccccagcccctacaccccgcttctcccggactctcccagcggacag
ccccccagccccacagcctga

DBGET integrated database retrieval system