KEGG   Homo sapiens (human): 949Help
Entry
949               CDS       T01001                                 

Gene name
SCARB1, CD36L1, CLA-1, CLA1, HDLQTL6, SR-BI, SRB1
Definition
scavenger receptor class B, member 1
Orthology
K13885  
scavenger receptor class B, member 1
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Ovarian steroidogenesis
Fat digestion and absorption
Bile secretion
Vitamin digestion and absorption
Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    949 (SCARB1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    949 (SCARB1)
  Digestive system
   04976 Bile secretion
    949 (SCARB1)
   04975 Fat digestion and absorption
    949 (SCARB1)
   04977 Vitamin digestion and absorption
    949 (SCARB1)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    949 (SCARB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   949 (SCARB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.31
AA seq 506 aa AA seqDB search
MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIP
IPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQ
FQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIM
WGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGL
SKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGVFEGIPTYR
FVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAVTG
LHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG
AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQGPEDTVSQPGLAA
GPDRPPSPYTPLLPDSPSGQPPSPTA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgggctgctccgccaaagcgcgctgggctgccggggcgctgggcgtcgcggggctactg
tgcgctgtgctgggcgctgtcatgatcgtgatggtgccgtcgctcatcaagcagcaggtc
cttaagaacgtgcgcatcgaccccagtagcctgtccttcaacatgtggaaggagatccct
atccccttctatctctccgtctacttctttgacgtcatgaaccccagcgagatcctgaag
ggcgagaagccgcaggtgcgggagcgcgggccctacgtgtacagggagttcaggcacaaa
agcaacatcaccttcaacaacaacgacaccgtgtccttcctcgagtaccgcaccttccag
ttccagccctccaagtcccacggctcggagagcgactacatcgtcatgcccaacatcctg
gtcttgggtgcggcggtgatgatggagaataagcccatgaccctgaagctcatcatgacc
ttggcattcaccaccctcggcgaacgtgccttcatgaaccgcactgtgggtgagatcatg
tggggctacaaggacccccttgtgaatctcatcaacaagtactttccaggcatgttcccc
ttcaaggacaagttcggattatttgctgagctcaacaactccgactctgggctcttcacg
gtgttcacgggggtccagaacatcagcaggatccacctcgtggacaagtggaacgggctg
agcaaggttgacttctggcattccgatcagtgcaacatgatcaatggaacttctgggcaa
atgtggccgcccttcatgactcctgagtcctcgctggagttctacagcccggaggcctgc
cgatccatgaagctaatgtacaaggagtcaggggtgtttgaaggcatccccacctatcgc
ttcgtggctcccaaaaccctgtttgccaacgggtccatctacccacccaacgaaggcttc
tgcccgtgcctggagtctggaattcagaacgtcagcacctgcaggttcagtgcccccttg
tttctctcccatcctcacttcctcaacgctgacccggttctggcagaagcggtgactggc
ctgcaccctaaccaggaggcacactccttgttcctggacatccacccggtcacgggaatc
cccatgaactgctctgtgaaactgcagctgagcctctacatgaaatctgtcgcaggcatt
ggacaaactgggaagattgagcctgtggtcctgccgctgctctggtttgcagagagcggg
gccatggagggggagactcttcacacattctacactcagctggtgttgatgcccaaggtg
atgcactatgcccagtacgtcctcctggcgctgggctgcgtcctgctgctggtccctgtc
atctgccaaatccggagccaaggtcctgaggacaccgtgagccagccaggcctggccgct
gggcctgaccggccccccagcccctacaccccgcttctcccggactctcccagcggacag
ccccccagccccacagcctga

DBGET integrated database retrieval system