KEGG   Homo sapiens (human): 9495Help
Entry
9495              CDS       T01001                                 

Gene name
AKAP5, AKAP75, AKAP79, H21
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  
A-kinase anchor protein 5
Organism
hsa  Homo sapiens (human)
Brite
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     9495 (AKAP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P24588(Tbio)
UniProt: 
Position
14q23.3
AA seq 427 aa AA seqDB search
METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVAR
KCPQEAGASDQPEPTRGAWASLKRLVTRRKRSESSKQQKPLEGEMQPAINAEDADLSKKK
AKSRLKIPCIKFPRGPKRSNHSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQ
DLSEGISRKDGDEVCESNVSNSTTSGEKVISVELGLDNGHSAIQTGTLILEEIETIKEKQ
DVQPQQASPLETSETDHQQPVLSDVPPLPAIPDQQIVEEASNSTLESAPNGKDYESTEIV
AEETKPKDTELSQESDFKENGITEEKSKSEESKRMEPIAIIITDTEISEFDVTKSKNVPK
QFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDN
KINNLLQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccacaatttcagaaattcatgtagaaaacaaggatgagaagagatcagcagaa
ggtagtcctggggctgaaaggcagaaggaaaaggcatccatgctttgcttcaagagaaga
aagaaagcagccaaagcactgaagcccaaagctggctctgaagctgctgatgtggcaagg
aagtgtccacaagaagcaggagcttctgatcagccagagcccacacggggggcctgggcc
tcactcaaacgtcttgtaacacgcaggaaaaggtcagagtcttcaaagcagcaaaagcca
ttggagggtgaaatgcaacctgcaataaatgctgaggatgctgatctttctaagaaaaag
gcaaaatctagacttaagattccctgcataaaattcccaagagggccaaaaaggagtaat
cattccaaaattatagaagactcagactgcagcatcaaagtccaggaagaagctgaaatt
ttggatatacaaacacagaccccattgaatgatcaggcaacaaaggctaagtcaacccag
gatctaagtgaaggcatctcacggaaagatggtgatgaggtctgtgaatcaaatgtgagc
aatagcacaacttctggagagaaagtgatttcagtagaacttggattagataatgggcat
tctgctattcaaacgggaactctaatccttgaagaaattgaaacgatcaaggaaaaacaa
gatgttcaaccccagcaagcaagcccacttgaaacttcagaaacagaccatcagcagcca
gtactttctgatgttcctcctttacctgcaattccagatcaacaaattgtggaagaagcc
agtaacagtaccctagaaagtgcaccaaatggaaaagactatgaaagtacagagattgta
gctgaagaaactaagccaaaagatactgaattgagccaagaatcagattttaaagaaaat
gggatcactgaagagaaatccaaatcagaagaaagcaaaagaatggagccaattgctatt
attattacagacactgaaatcagtgaatttgatgttacaaaatctaaaaatgtccctaag
caattcttaatttcagctgaaaatgagcaagtaggggtttttgctaatgataatggtttt
gaggatagaacttcagaacaatatgaaacactcttaattgaaacagcctcttctctagtc
aagaatgctattcagttgtcaatagaacagctggttaatgaaatggcctctgatgataat
aaaataaacaatcttctacagtga

DBGET integrated database retrieval system