KEGG   Homo sapiens (human): 9496Help
Entry
9496              CDS       T01001                                 

Gene name
TBX4, SPS
Definition
T-box 4
Orthology
K10178  
T-box protein 4
Organism
hsa  Homo sapiens (human)
Disease
H00464  
Patella dysplasias
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21-q22
AA seq 545 aa AA seqDB search
MLQDKGLSESEEAFRAPGPALGEASAANAPEPALAAPGLSGAALGSPPGPGADVVAAAAA
EQTIENIKVGLHEKELWKKFHEAGTEMIITKAGRRMFPSYKVKVTGMNPKTKYILLIDIV
PADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDP
FGHIILNSMHKYQPRLHIVKADENNAFGSKNTAFCTHVFPETSFISVTSYQNHKITQLKI
ENNPFAKGFRGSDDSDLRVARLQSKEYPVISKSIMRQRLISPQLSATPDVGPLLGTHQAL
QHYQHENGAHSQLAEPQDLPLSTFPTQRDSSLFYHCLKRRDGTRHLDLPCKRSYLEAPSS
VGEDHYFRSPPPYDQQMLSPSYCSEVTPREACMYSGSGPEIAGVSGVDDLPPPPLSCNMW
TSVSPYTSYSVQTMETVPYQPFPTHFTATTMMPRLPTLSAQSSQPPGNAHFSVYNQLSQS
QVRERGPSASFPRERGLPQGCERKPPSPHLNAANEFLYSQTFSLSRESSLQYHSGMGTVE
NWTDG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggataagggcctgtccgagagcgaggaggccttccgggccccgggcccagcg
ctcggagaggccagcgcagccaacgcccccgagcccgcgctggcagcgccgggcctcagc
ggagccgcgctaggcagccccccgggacccggggccgacgtcgtcgccgccgccgccgcg
gagcagaccatcgagaacatcaaggtggggctgcatgagaaggagctctggaagaagttc
cacgaggcgggcaccgagatgatcatcactaaggctggcaggaggatgttccccagctac
aaggtaaaagtcacaggcatgaaccccaagaccaagtatatcctgctgattgacattgtc
cctgccgatgaccatcgctacaagttctgtgacaacaaatggatggtggcagggaaggct
gagccagccatgccaggaaggctgtatgtccacccggattctcctgccacaggagcccac
tggatgcggcagctggtctccttccagaagctgaagctgacaaacaaccacctggacccc
tttggccatatcatcctcaactctatgcacaagtaccagccgcggctccacatcgttaag
gctgatgagaacaatgctttcggctccaaaaacactgctttctgcacccacgtgttccca
gagacctccttcatctctgtgacctcctaccagaatcacaagatcacccagctgaaaatt
gagaacaacccttttgccaagggattccggggcagtgatgacagtgacctgcgtgtggcc
cgactgcagagcaaagaataccccgtgatttccaaaagcatcatgaggcagaggctcatc
tccccccagctctcagccacaccggacgtgggccccctgctcggcacccaccaggcactc
cagcactaccagcacgagaacggggcacactcacagctcgcggagccgcaggacctgccc
ctcagcacctttcccacccagagggactcaagcctcttctatcactgcctgaaaagacga
gacggtacccgccacctggacttaccttgcaagcgatcctatctggaagccccctcttcg
gtgggggaggatcactatttccgttccccccctccctacgaccagcaaatgctgagcccc
tcctactgcagtgaggtgacccccagagaagcatgtatgtactcaggttcagggcccgag
attgccggggtgtctggggtggacgacctgcccccacctccgctgagctgtaacatgtgg
acttcagtgtcgccgtacaccagctatagcgtgcagacgatggagactgtgccgtaccag
cccttccccacgcacttcaccgccaccaccatgatgccgcggctgcccaccctctccgct
cagagctcccagccaccaggaaatgcccactttagtgtctacaatcagctctcccagtct
caggtccgagagcgggggcccagcgcctcattcccaagagagcgcggcctcccccaaggg
tgtgagaggaagccaccctcgccacatctaaatgctgccaatgagtttctctactctcaa
accttctccttgtcccgagaatcttccttacagtaccattcaggaatggggactgtggag
aactggactgacggatga

DBGET integrated database retrieval system