KEGG   Homo sapiens (human): 9519Help
Entry
9519              CDS       T01001                                 

Gene name
TBPL1, MGC:8389, MGC:9620, STUD, TLF, TLP, TRF2
Definition
TBP-like 1
Orthology
K03120  
transcription initiation factor TFIID TATA-box-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Huntington's disease
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    9519 (TBPL1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    9519 (TBPL1)
  Neurodegenerative diseases
   05016 Huntington's disease
    9519 (TBPL1)
  Infectious diseases
   05166 HTLV-I infection
    9519 (TBPL1)
   05168 Herpes simplex infection
    9519 (TBPL1)
   05169 Epstein-Barr virus infection
    9519 (TBPL1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    9519 (TBPL1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     9519 (TBPL1)
  RNA polymerase III system
    TFIIIB
     9519 (TBPL1)
  RNA polymerase I system
    SL1/TIF-1B
     9519 (TBPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
6q22.1-q22.3
AA seq 186 aa AA seqDB search
MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATI
WSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEF
TKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFE
SRKEIL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggatgcagacagtgatgttgcattggacattctaattacaaatgtagtctgtgttttt
agaacaagatgtcatttaaacttaaggaagattgctttggaaggagcaaatgtaatttat
aaacgtgatgttggaaaagtattaatgaagcttagaaaacctagaattacagctacaatt
tggtcctcaggaaaaattatttgcactggagcaacaagtgaagaagaagctaaatttggt
gccagacgcttagcccgtagtctgcagaaactaggttttcaggtaatatttacagatttt
aaggttgttaacgttctggcagtgtgtaacatgccatttgaaatccgtttgccagaattc
acaaagaacaatagacctcatgccagttacgaacctgaacttcatcctgctgtgtgctat
cggataaaatctctaagagctacattacagattttttcaacaggaagtatcacagtaaca
gggcccaatgtaaaggctgttgctactgctgtggaacagatttacccatttgtgtttgaa
agcaggaaagaaattttataa

DBGET integrated database retrieval system