KEGG   Homo sapiens (human): 9526Help
Entry
9526              CDS       T01001                                 

Gene name
MPDU1, CDGIF, HBEBP2BPA, Lec35, My008, PP3958, PQLC5, SL15
Definition
mannose-P-dolichol utilization defect 1
Orthology
K09660  
mannose-P-dolichol utilization defect 1
Organism
hsa  Homo sapiens (human)
Disease
H00118  
Congenital disorders of glycosylation (CDG) type I
Brite
Glycosyltransferases [BR:hsa01003]
 Others
  Other glycosyltransferases
   9526 (MPDU1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1-p12
AA seq 247 aa AA seqDB search
MAAEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLP
QVFKILGAKSAEGLSLQSVMLELVALTGTMVYSITNNFPFSSWGEALFLMLQTITICFLV
MHYRGQTVKGVAFLACYGLVLLVLLSPLTPLTVVTLLQASNVPAVVVGRLLQAATNYHNG
HTGQLSAITVFLLFGGSLARIFTSIQETGDPLMAGTFVVSSLCNGLIAAQLLFYWNAKPP
HKQKKAQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgaggcggacggaccgcttaaacggctgctcgtgccgattcttttacctgag
aaatgctacgaccaacttttcgttcagtgggacttgcttcacgtcccctgcctcaagatt
ctcctcagcaaaggcctggggctgggcattgtggctggctcacttctagtaaagctgccc
caggtgtttaaaatcctgggagccaagagtgctgaagggttgagtctccagtctgtaatg
ctggagctagtggcattgactgggaccatggtctacagcatcactaacaacttcccattc
agctcttggggtgaagccttattcctgatgctccagacgatcaccatctgcttcctggtc
atgcactacagaggacagactgtgaaaggtgtcgctttcctcgcttgctacggcctggtc
ctgctggtgcttctctcacctctgacgcccttgactgtagtcaccctgctccaggcctcc
aatgtgcctgctgtggtggtggggaggcttctccaggcagccaccaactaccacaacggg
cacacaggccagctctcagccatcacagtcttcctgctgtttgggggctccctggcccga
atcttcacttccattcaggaaaccggagatcccctgatggctgggacctttgtggtctcc
tctctctgcaacggcctcatcgccgcccagctgctcttctactggaatgcaaagcctccc
cacaagcagaaaaaggcgcagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system