KEGG   Homo sapiens (human): 9527Help
Entry
9527              CDS       T01001                                 

Gene name
GOSR1, GOLIM2, GOS-28, GOS28, GOS28/P28, GS28, P28
Definition
(RefSeq) golgi SNAP receptor complex member 1
  KO
K08495  
golgi SNAP receptor complex member 1
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    9527 (GOSR1)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNAP-25[N] (Qb)
   Gos1 (Gos28)
    9527 (GOSR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O95249(Tbio)
UniProt: 
Position
17q11.2
AA seq 250 aa AA seqDB search
MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNG
SSQDRMFETMAIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTH
EFHKTKANFMAIRERENLMGSVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEET
ISIAMATKENMTSQRGMLKSIHSKMNTLANRFPAVNSLIQRINLRKRRDSLILGGVIGIC
TILLLLYAFH
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagggaccagcagttactgggaagatctcaggaaacaggctcgacagctggaa
aatgaacttgacctgaaactagtttccttcagcaaactatgtacaagttacagtcatagc
agtacccgagatggaagacgcgacaggtatagttctgatacaacaccccttttaaatgga
tcaagccaagacagaatgtttgagacaatggcgattgagattgaacaacttttggcaagg
cttacaggggtaaatgataaaatggcagaatataccaacagtgcaggtgtcccctccttg
aatgcagccctgatgcatacattacagcggcatagagacatattgcaggattatacacat
gaattccataaaaccaaagcaaactttatggcaatacgggaaagggagaatcttatggga
tcagtacgaaaagatattgagtcatataaaagtgggtctggagtaaacaacagaagaact
gagctatttttgaaagaacatgaccaccttcgaaactcagatcgtctgatagaagagaca
ataagcattgctatggcaacaaaagaaaatatgacttcacagagaggaatgttgaagtca
attcacagcaaaatgaacactttggccaatcgttttcctgctgtaaacagcctgatccag
aggatcaacctgaggaagcggcgggactcgctcatcctagggggtgttattgggatctgt
accatcctgttgctgctgtatgcgttccattga

DBGET integrated database retrieval system