KEGG   Homo sapiens (human): 9531Help
Entry
9531              CDS       T01001                                 

Gene name
BAG3, BAG-3, BIS, CAIR-1, MFM6
Definition
(RefSeq) BCL2 associated athanogene 3
  KO
K09557  
BCL2-associated athanogene 3
Organism
hsa  Homo sapiens (human)
Disease
H00595  
Myofibrillar myopathies (MFM)
Brite
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  BAG
   9531 (BAG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q25.2-q26.2
AA seq 575 aa AA seqDB search
MSAATHSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPK
ETPSSANGPSREGSRLPPAREGHPVYPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQ
RFRTEAAAAAPQRSQSPLRGMPETTQPDKQCGQVAAAAAAQPPASHGPERSQSPAASDCS
SSSSSASLPSSGRSSLGSHQLPRGYISIPVIHEQNVTRPAAQPSFHQAQKTHYPAQQGEY
QTHQPVYHKIQGDDWEPRPLRAASPFRSSVQGASSREGSPARSSTPLHSPSPIRVHTVVD
RPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRKEVDSKPVSQKPPPPSE
KVEVKVPPAPVPCPPPSPGPSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHP
GVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQAR
RDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAG
NAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgccacccactcgcccatgatgcaggtggcgtccggcaacggtgaccgcgac
cctttgccccccggatgggagatcaagatcgacccgcagaccggctggcccttcttcgtg
gaccacaacagccgcaccactacgtggaacgacccgcgcgtgccctctgagggccccaag
gagactccatcctctgccaatggcccttcccgggagggctctaggctgccgcctgctagg
gaaggccaccctgtgtacccccagctccgaccaggctacattcccattcctgtgctccat
gaaggcgctgagaaccggcaggtgcaccctttccatgtctatccccagcctgggatgcag
cgattccgaactgaggcggcagcagcggctcctcagaggtcccagtcacctctgcggggc
atgccagaaaccactcagccagataaacagtgtggacaggtggcagcggcggcggcagcc
cagcccccagcctcccacggacctgagcggtcccagtctccagctgcctctgactgctca
tcctcatcctcctcggccagcctgccttcctccggcaggagcagcctgggcagtcaccag
ctcccgcgggggtacatctccattccggtgatacacgagcagaacgttacccggccagca
gcccagccctccttccaccaagcccagaagacgcactacccagcgcagcagggggagtac
cagacccaccagcctgtgtaccacaagatccagggggatgactgggagccccggcccctg
cgggcggcatccccgttcaggtcatctgtccagggtgcatcgagccgggagggctcacca
gccaggagcagcacgccactccactccccctcgcccatccgtgtgcacaccgtggtcgac
aggcctcagcagcccatgacccatcgagaaactgcacctgtttcccagcctgaaaacaaa
ccagaaagtaagccaggcccagttggaccagaactccctcctggacacatcccaattcaa
gtgatccgcaaagaggtggattctaaacctgtttcccagaagcccccacctccctctgag
aaggtagaggtgaaagttccccctgctccagttccttgtcctcctcccagccctggccct
tctgctgtcccctcttcccccaagagtgtggctacagaagagagggcagcccccagcact
gcccctgcagaagctacacctccaaaaccaggagaagccgaggctcccccaaaacatcca
ggagtgctgaaagtggaagccatcctggagaaggtacaggggctggagcaggctgtagac
aactttgaaggcaagaagactgacaaaaagtacctgatgatcgaagagtatttgaccaaa
gagctgctggccctggattcagtggaccccgagggacgagccgatgtgcgtcaggccagg
agagacggtgtcaggaaggttcagaccatcttggaaaaacttgaacagaaagccattgat
gtcccaggtcaagtccaggtctatgaactccagcccagcaaccttgaagcagatcagcca
ctgcaggcaatcatggagatgggtgccgtggcagcagacaagggcaagaaaaatgctgga
aatgcagaagatccccacacagaaacccagcagccagaagccacagcagcagcgacttca
aaccccagcagcatgacagacacccctggtaacccagcagcaccgtag

DBGET integrated database retrieval system