KEGG   Homo sapiens (human): 9538Help
Entry
9538              CDS       T01001                                 

Gene name
EI24, EPG4, PIG8, TP53I8
Definition
etoposide induced 2.4
Orthology
K10134  
etoposide-induced 2.4 mRNA
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    9538 (EI24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
11q24
AA seq 326 aa AA seqDB search
MADSVKTFLQDLARLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIFQC
CAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEFFLTSIFSALWVLPL
FVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQGMFVSLF
PIHLVGQLVSLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTA
MQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSA
LSSSTSAEKFPSPHPSPAKLKATAGH
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctgacagtgtcaaaacctttctccaggaccttgccagactagatgctcgaatccag
caaaagagagaggagcagcgtcgaagaagggcaagtagtgtcttggcacagagaagagcc
cagagtatagagcggaagcaagagagtgagccacgtattgttagtagaattttccagtgt
tgtgcttggaatggtggagtgttctggttcagtctcctcttgttttatcgagtatttatt
cctgtgcttcagtcggtaacagcccgaattatcggtgacccatcactacatggagatgtt
tggtcgtggctggaattcttcctcacgtcaattttcagtgctctttgggtgctccccttg
tttgtgcttagcaaagtggtgaatgccatttggtttcaggatatagctgacctggcattt
gaggtatcagggaggaagcctcacccattccctagtgtcagcaaaataattgctgacatg
ctcttcaaccttttgctgcaggctcttttcctcattcagggaatgtttgtgagtctcttt
cccatccatcttgtcggtcagctggttagtctcctgcatatgtcccttctctactcactg
tactgctttgaatatcgttggttcaataaaggaattgaaatgcaccagcggttgtctaac
atagaaaggaattggccttactactttgggtttggtttgcccttggcttttctcacagca
atgcagtcctcatatattatcagtggctgccttttctctatcctctttcctttattcatt
atcagcgccaatgaagcaaagacccctggcaaagcatatctcttccagttgcgcctcttc
tccttggtggtcttcttaagcaacagactcttccacaagacagtctacctgcagtcggcc
ctgagcagctctacttctgcagagaagttcccttcaccgcatccgtcgcctgccaaactg
aaggctactgcaggtcactga

DBGET integrated database retrieval system