KEGG   Homo sapiens (human): 9538Help
Entry
9538              CDS       T01001                                 

Gene name
EI24, EPG4, PIG8, TP53I8
Definition
(RefSeq) EI24, autophagy associated transmembrane protein
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    9538 (EI24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EI24
Motif
Other DBs
NCBI-GeneID: 9538
NCBI-ProteinID: NP_004870
OMIM: 605170
HGNC: 13276
Ensembl: ENSG00000149547
Vega: OTTHUMG00000165851
Pharos: O14681(Tbio)
UniProt: O14681 A0A024R3I8
Position
11q24.2
AA seq 340 aa AA seqDB search
MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERK
QESEPRIVSRIFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEF
FLTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLL
QALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWP
YYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFL
SNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATAGH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggctgacagtgtcaaaacctttctccaggaccttgccagaggaatcaaagactccatc
tggggtatttgtaccatctcaaagctagatgctcgaatccagcaaaagagagaggagcag
cgtcgaagaagggcaagtagtgtcttggcacagagaagagcccagagtatagagcggaag
caagagagtgagccacgtattgttagtagaattttccagtgttgtgcttggaatggtgga
gtgttctggttcagtctcctcttgttttatcgagtatttattcctgtgcttcagtcggta
acagcccgaattatcggtgacccatcactacatggagatgtttggtcgtggctggaattc
ttcctcacgtcaattttcagtgctctttgggtgctccccttgtttgtgcttagcaaagtg
gtgaatgccatttggtttcaggatatagctgacctggcatttgaggtatcagggaggaag
cctcacccattccctagtgtcagcaaaataattgctgacatgctcttcaaccttttgctg
caggctcttttcctcattcagggaatgtttgtgagtctctttcccatccatcttgtcggt
cagctggttagtctcctgcatatgtcccttctctactcactgtactgctttgaatatcgt
tggttcaataaaggaattgaaatgcaccagcggttgtctaacatagaaaggaattggcct
tactactttgggtttggtttgcccttggcttttctcacagcaatgcagtcctcatatatt
atcagtggctgccttttctctatcctctttcctttattcattatcagcgccaatgaagca
aagacccctggcaaagcatatctcttccagttgcgcctcttctccttggtggtcttctta
agcaacagactcttccacaagacagtctacctgcagtcggccctgagcagctctacttct
gcagagaagttcccttcaccgcatccgtcgcctgccaaactgaaggctactgcaggtcac
tga

DBGET integrated database retrieval system