KEGG   Homo sapiens (human): 954Help
Entry
954               CDS       T01001                                 

Gene name
ENTPD2, CD39L1, NTPDase-2
Definition
ectonucleoside triphosphate diphosphohydrolase 2 (EC:3.6.1.-)
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    954 (ENTPD2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     954 (ENTPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34
AA seq 472 aa AA seqDB search
MAGKVRSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPA
DKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLG
ATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENF
IKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSF
LCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVS
LSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMG
LPVATLQQLEAAAVNVCNQTWAQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLN
LTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALVLLLRQVHSAKLPSTI
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaaggtgcggtcactgctgccgccgctgctgctggccgccgcgggcctcgcc
ggcctcctactgctgtgcgtccccacccgcgacgtccgggagccgcccgccctcaagtat
ggcatcgtcctggacgctggttcttcacacacgtccatgtttatctacaagtggccggca
gacaaggagaacgacacaggcattgtgggccagcacagctcctgtgatgttccaggtggg
ggcatctccagctatgcagacaacccttctggggccagccagagtcttgttggatgcctc
gaacaggcgcttcaggatgtgcccaaagagagacacgcgggcacacccctctacctggga
gccacagcgggtatgcgcctgctcaacctgaccaatccagaggcctcgaccagtgtgctc
atggcagtgactcacacactgacccagtacccctttgacttccggggtgcacgcatcctc
tcgggccaggaagagggggtgtttggctgggtgactgccaactacctgctggagaacttc
atcaagtacggctgggtgggccggtggttccggccacggaaggggacactgggggccatg
gacctggggggtgcctctacccagatcacttttgagacaaccagtccagctgaggacaga
gccagcgaggtccagctgcatctctacggccagcactaccgagtctacacccacagcttc
ctctgctatggccgtgaccaggtcctccagaggctgctggccagcgccctccagacccac
ggcttccacccctgctggccgaggggcttttccacccaagtgctgctcggggatgtgtac
cagtcaccatgcaccatggcccagcggccccagaacttcaacagcagtgccagggtcagc
ctgtcagggagcagtgacccccacctctgccgagatctggtttctgggctcttcagcttc
tcctcctgccccttctcccgatgctctttcaatggggtcttccagcccccagtggctggg
aactttgtggccttctctgccttcttctacactgtggactttttgcggacttcgatgggg
ctgcccgtggccaccctgcagcagctggaggcagccgcagtgaatgtctgcaaccagacc
tgggctcagcagctgctgagtcgcggctacggcttcgacgagcgcgccttcggcggcgtg
atcttccagaagaaggccgcggacactgcagtgggctgggcgctcggctacatgctgaac
ctgaccaacctgatccccgccgacccgccggggctgcgcaagggcacagacttcagctcc
tgggtcgtcctcctgctgctcttcgcctccgcgctcctggctgcgcttgtcctgctgctg
cgtcaggtgcactccgccaagctgccaagcaccatttag

DBGET integrated database retrieval system