KEGG   Homo sapiens (human): 9540Help
Entry
9540              CDS       T01001                                 

Gene name
TP53I3, PIG3
Definition
(RefSeq) tumor protein p53 inducible protein 3
  KO
K10133  tumor protein p53-inducible protein 3 [EC:1.-.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    9540 (TP53I3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     9540 (TP53I3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N HupF_HypC
Motif
Other DBs
NCBI-GeneID: 9540
NCBI-ProteinID: NP_004872
OMIM: 605171
HGNC: 19373
Ensembl: ENSG00000115129
Vega: OTTHUMG00000090817
Pharos: Q53FA7(Tbio)
UniProt: Q53FA7
Structure
PDB: 

Jmol
Position
2p23.3
AA seq 332 aa AA seqDB search
MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNI
LGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAA
IPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQM
AEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGL
MGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPV
LDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgttagccgtgcactttgacaagccgggaggaccggaaaacctctacgtgaaggaggtg
gccaagccgagcccgggggagggtgaagtcctcctgaaggtggcggccagcgccctgaac
cgggcggacttaatgcagagacaaggccagtatgacccacctccaggagccagcaacatt
ttgggacttgaggcatctggacatgtggcagagctggggcctggctgccagggacactgg
aagatcggggacacagccatggctctgctccccggtgggggccaggctcagtacgtcact
gtccccgaagggctcctcatgcctatcccagagggattgaccctgacccaggctgcagcc
atcccagaggcctggctcaccgccttccagctgttacatcttgtgggaaatgttcaggct
ggagactatgtgctaatccatgcaggactgagtggtgtgggcacagctgctatccaactc
acccggatggctggagctattcctctggtcacagctggctcccagaagaagcttcaaatg
gcagaaaagcttggagcagctgctggattcaattacaaaaaagaggatttctctgaagca
acgctgaaattcaccaaaggtgctggagttaatcttattctagactgcataggcggatcc
tactgggagaagaacgtcaactgcctggctcttgatggtcgatgggttctctatggtctg
atgggaggaggtgacatcaatgggcccctgttttcaaagctactttttaagcgaggaagt
ctgatcaccagtttgctgaggtctagggacaataagtacaagcaaatgctggtgaatgct
ttcacggagcaaattctgcctcacttctccacggagggcccccaacgtctgctgccggtt
ctggacagaatctacccagtgaccgaaatccaggaggcccataagtacatggaggccaac
aagaacataggcaagatcgtcctggaactgccccagtga

DBGET integrated database retrieval system