KEGG   Homo sapiens (human): 9542Help
Entry
9542              CDS       T01001                                 

Gene name
NRG2, DON1, HRG2, NTAK
Definition
(RefSeq) neuregulin 2
  KO
K05456  
neuregulin 2
Organism
hsa  Homo sapiens (human)
Pathway
EGFR tyrosine kinase inhibitor resistance
ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    9542 (NRG2)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    9542 (NRG2)
Cytokines [BR:hsa04052]
 PDGF family
  Other growth factors
   9542 (NRG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O14511(Tbio)
UniProt: 
Position
5q31.2
AA seq 850 aa AA seqDB search
MRQVCCSALPPPPLEKGRCSSYSDSSSSSSERSSSSSSSSSESGSSSRSSSNNSSISRPA
APPEPRPQQQPQPRSPAARRAAARSRAAAAGGMRRDPAPGFSMLLFGVSLACYSPSLKSV
QDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVI
SVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLK
KMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNK
VKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCY
YIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKRVLTITGICVALLVVG
IVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADYISKNVPA
TDHVIRRETETTFSGSHSCSPSHHCSTATPTSSHRHESHTWSLERSESLTSDSQSGIMLS
SVGTSKCNSPACVEARARRAAAYNLEERRRATAPPYHDSVDSLRDSPHSERYVSALTTPA
RLSPVDFHYSLATQVPTFEITSPNSAHAVSLPPAAPISYRLAEQQPLLRHPAPPGPGPGP
GPGPGPGADMQRSYDSYYYPAAGPGPRRGTCALGGSLGSLPASPFRIPEDDEYETTQECA
PPPPPRPRARGASRRTSAGPRRWRRSRLNGLAAQRARAARDSLSLSSGSGGGSASASDDD
ADDADGALAAESTPFLGLRGAHDALRSDSPPLCPAADSRTYYSLDSHSTRASSRHSRGPP
PRAKQDSAPL
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaggtttgctgctcagcgctgccgccgccgccactggagaagggtcggtgcagc
agctacagcgacagcagcagcagcagcagcgagaggagcagcagcagcagcagcagcagc
agcgagagcggcagcagcagcaggagcagcagcaacaacagcagcatctctcgtcccgct
gcgcccccagagccgcggccgcagcaacagccgcagccccgcagccccgcagcccggaga
gccgccgcccgttcgcgagccgcagccgccggcggcatgaggcgcgacccggcccccggc
ttctccatgctgctcttcggtgtgtcgctcgcctgctactcgcccagcctcaagtcagtg
caggaccaggcgtacaaggcacccgtggtggtggagggcaaggtacaggggctggtccca
gccggcggctccagctccaacagcacccgagagccgcccgcctcgggtcgggtggcgttg
gtaaaggtgctggacaagtggccgctccggagcggggggctgcagcgcgagcaggtgatc
agcgtgggctcctgtgtgccgctcgaaaggaaccagcgctacatctttttcctggagccc
acggaacagcccttagtctttaagacggcctttgcccccctcgataccaacggcaaaaat
ctcaagaaagaggtgggcaagatcctgtgcactgactgcgccacccggcccaagttgaag
aagatgaagagccagacgggacaggtgggtgagaagcaatcgctgaagtgtgaggcagca
gccggtaatccccagccttcctaccgttggttcaaggatggcaaggagctcaaccgcagc
cgagacattcgcatcaaatatggcaacggcagaaagaactcacgactacagttcaacaag
gtgaaggtggaggacgctggggagtatgtctgcgaggccgagaacatcctggggaaggac
accgtccggggccggctttacgtcaacagcgtgagcaccaccctgtcatcctggtcgggg
cacgcccggaagtgcaacgagacagccaagtcctattgcgtcaatggaggcgtctgctac
tacatcgagggcatcaaccagctctcctgcaaatgtccaaatggattcttcggacagaga
tgtttggagaaactgcctttgcgattgtacatgccagatcctaagcaaaaagccgaggag
ctgtaccagaagagggtcctgaccatcacgggcatctgcgtggctctgctggtcgtgggc
atcgtctgtgtggtggcctactgcaagaccaaaaaacagcggaagcagatgcacaaccac
ctccggcagaacatgtgcccggcccatcagaaccggagcttggccaatgggcccagccac
ccccggctggacccagaggagatccagatggcagattatatttccaagaacgtgccagcc
acagaccatgtcatcaggagagaaactgagaccaccttctctgggagccactcctgttct
ccttctcaccactgctccacagccacacccacctccagccacagacacgagagccacacg
tggagcctggaacgttctgagagcctgacttctgactcccagtcggggatcatgctatca
tcagtgggtaccagcaaatgcaacagcccagcatgtgtggaggcccgggcaaggcgggca
gcagcctacaacctggaggagcggcgcagggccaccgcgccaccctatcacgattccgtg
gactcccttcgcgactccccacacagcgagaggtacgtgtcggccctgaccacgcccgcg
cgcctctcgcccgtggacttccactactcgctggccacgcaggtgccaactttcgagatc
acgtcccccaactcggcgcacgccgtgtcgctgccgccggcggcgcccatcagttaccgc
ctggccgagcagcagccgttactgcggcacccggcgccccccggcccgggacccggaccc
gggcccgggcccgggcccggcgcagacatgcagcgcagctatgacagctactattacccc
gcggcggggcccggaccgcggcgcgggacctgcgcgctcggcggcagcctgggcagcctg
cctgccagccccttccgcatccccgaggacgacgagtacgagaccacgcaggagtgcgcg
cccccgccgccgccgcggccgcgcgcgcgcggtgcgtcccgcaggacgtcggcggggccc
cggcgctggcgccgctcgcgcctcaacgggctggcggcgcagcgcgcacgggcggcgagg
gactcgctgtcgctgagcagcggctcgggcggcggctcagcctcggcgtcggacgacgac
gcggacgacgcggacggggcgctggcggccgagagcacacctttcctgggcctgcgtggg
gcgcacgacgcgctgcgctcggactcgccgccactgtgcccggcggccgacagcaggact
tactactcactggacagccacagcacgcgggccagcagcagacacagccgcgggccgccc
ccgcgggccaagcaggactcggcgccactctag

DBGET integrated database retrieval system