KEGG   Homo sapiens (human): 9545Help
Entry
9545              CDS       T01001                                 

Gene name
RAB3D, D2-2, GOV, RAB16, RAD3D
Definition
RAB3D, member RAS oncogene family
Orthology
K07884  
Ras-related protein Rab-3D
Organism
hsa  Homo sapiens (human)
Pathway
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    9545 (RAB3D)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   9545 (RAB3D)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    9545 (RAB3D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 219 aa AA seqDB search
MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFK
VKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQI
KTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLV
DVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagctggagacacccaggcaggcccacgggatgcagcagatcagaacttcgac
tatatgttcaaactgctactgataggcaacagcagtgtgggcaagacttccttcctgttc
cgatacgcggacgactccttcactcccgccttcgtcagtactgtgggcatcgatttcaag
gtcaagaccgtctaccgccatgacaagaggatcaagctgcagatctgggacacagcgggc
caggagcgctaccgcaccatcaccacggcctactaccggggagccatgggcttcctgctc
atgtatgacatcgccaatcaggaatcctttgccgctgtgcaggactgggccacgcaaatc
aagacctactcctgggacaacgcccaggtcatcctggtggggaacaagtgtgacctggag
gacgaacgtgttgtgcctgctgaggatggccggaggctcgccgacgaccttggtttcgag
ttctttgaagccagtgccaaggagaacatcaatgtgaagcaggtcttcgagcgcctggtg
gatgtcatctgcgagaagatgaacgagtccctggaacccagctccagctcaggcagcaac
gggaaaggcccggccgtgggggatgctccagccccccagcccagcagctgcagctgctag

DBGET integrated database retrieval system