KEGG   Homo sapiens (human): 9547Help
Entry
9547              CDS       T01001                                 

Gene name
CXCL14, BMAC, BRAK, KEC, KS1, MIP-2g, MIP2G, NJAC, SCYB14
Definition
chemokine (C-X-C motif) ligand 14
Orthology
K10033  
C-X-C motif chemokine 14
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9547 (CXCL14)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    9547 (CXCL14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31
AA seq 111 aa AA seqDB search
MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKY
PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgctcccacgccgcgcccctccggtcagcatgaggctcctggcggccgcgctg
ctcctgctgctgctggcgctgtacaccgcgcgtgtggacgggtccaaatgcaagtgctcc
cggaagggacccaagatccgctacagcgacgtgaagaagctggaaatgaagccaaagtac
ccgcactgcgaggagaagatggttatcatcaccaccaagagcgtgtccaggtaccgaggt
caggagcactgcctgcaccccaagctgcagagcaccaagcgcttcatcaagtggtacaac
gcctggaacgagaagcgcagggtctacgaagaatag

DBGET integrated database retrieval system