KEGG   Homo sapiens (human): 9551Help
Entry
9551              CDS       T01001                                 

Gene name
ATP5J2, ATP5JL
Definition
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2 (EC:3.6.1.14)
Orthology
K02130  
F-type H+-transporting ATPase subunit f
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    9551 (ATP5J2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q22.1
AA seq 88 aa AA seqDB search
MASVVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGI
TMVLACYVLFSYSFSYKHLKHERLRKYH
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagttgtaccagtgaaggacaagaaacttctggaggtcaaactgggggagctg
ccaagctggatcttgatgcgggacttcagtcctagtggcattttcggagcgtttcaaaga
ggttactaccggtactacaacaagtacatcaatgtgaagaaggggagcatctcggggatt
accatggtgctggcatgctacgtgctctttagctactccttttcctacaagcatctcaag
cacgagcggctccgcaaataccactga

DBGET integrated database retrieval system